Psalmotoxin-1, ASIC1a blocker (ab120483)
Key features and details
- Potent, selective ASIC1a blocker
- Soluble in water
- Form / State: Solid
- Source: Synthetic
Overview
-
Product name
Psalmotoxin-1, ASIC1a blocker -
Description
Potent, selective ASIC1a blocker -
Alternative names
- PcTx1
-
Biological description
Potent, selective acid sensing (proton gated) ion channel 1a (ASIC1a) blocker. Inhibits cation currents mediated by ASICs (IC50 = 36 pM). Displays highly potent analgesic properties against neuropathic pain.
-
Chemical structure
Properties
-
Molecular weight
4689.41 -
Molecular formula
C200H312N62O57S6 -
Sequence
EDCIPKWKGCVNRHGDCCEGLECWKRRRSFEVCVPKTPKT (Modifications: Disulfide bonds: 3-18, 10-23, 17-33) -
PubChem identifier
90489000 -
Storage instructions
Store at -20°C. Store under desiccating conditions. The product can be stored for up to 12 months. -
Solubility overview
Soluble in water -
Handling
Wherever possible, you should prepare and use solutions on the same day. However, if you need to make up stock solutions in advance, we recommend that you store the solution as aliquots in tightly sealed vials at -20°C. Generally, these will be useable for up to one week. Before use, and prior to opening the vial we recommend that you allow your product to equilibrate to room temperature for at least 1 hour.
Need more advice on solubility, usage and handling? Please visit our frequently asked questions (FAQ) page for more details.
-
Source
Synthetic
-
Research areas