omega-Grammotoxin SIA, P/Q and N-type voltage-dependent Ca2+ channel blocker (ab141803)
Key features and details
- Potent P/Q and N-type voltage-dependent Ca2+ channel blocker
- CAS Number: 152617-90-8
- Purity: > 98%
- Soluble in water
- Form / State: Solid
- Source: Grammostola rosea
Overview
-
Product name
omega-Grammotoxin SIA, P/Q and N-type voltage-dependent Ca2+ channel blocker -
Description
Potent P/Q and N-type voltage-dependent Ca2+ channel blocker -
Biological description
Potent P/Q and N-type voltage-dependent Ca2+ channel blocker. Completely inhibits inward P currents at concentrations over 50 nM. Binds to binds to K+ channels with lower affinity. -
Purity
> 98% -
CAS Number
152617-90-8 -
Chemical structure
Properties
-
Molecular weight
4113.00 -
Molecular formula
C177H268N52O50S6 -
Sequence
DCVRFWGKCSQTSDCCPHLACKSKWPRNICVWDGSV (Modifications: Disulfide bonds: 2-16, 9-21, 15-30) -
Storage instructions
Store at -20°C. Store under desiccating conditions. The product can be stored for up to 12 months. -
Solubility overview
Soluble in water -
Handling
Wherever possible, you should prepare and use solutions on the same day. However, if you need to make up stock solutions in advance, we recommend that you store the solution as aliquots in tightly sealed vials at -20°C. Generally, these will be useable for up to one week. Before use, and prior to opening the vial we recommend that you allow your product to equilibrate to room temperature for at least 1 hour.
Need more advice on solubility, usage and handling? Please visit our frequently asked questions (FAQ) page for more details.
-
Source
Grammostola rosea
-
Research areas
Images
-
?-Grammotoxin SIA inhibits CaV2.2 channels heterologously expressed in Xenopus oocytes.
Left: Time course showing current amplitude in response to 100 ms test pulse to 0 mV delivered every 10 seconds before, during (bar) and after application of 500 nM ?-Grammotoxin SIA (ab141803), which inhibits 60% of N-type currents. The box denoting +100 mV shows the period in which similar pulses to +100 mV were delivered in order to partially relieve the inhibition. Right: The current traces were taken at the indicated positions.