Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category
Biochemicals Product Range Just Add Water

omega-Agatoxin IVA, Ca2+ channel blocker (P and Q type) (ab120210)

Price and availability

324 988 ₸

Availability

Order now and get it on Thursday February 25, 2021

omega-Agatoxin IVA, Ca<sup>2+</sup> channel blocker (P and Q type) (ab120210)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)

Key features and details

  • Ca2+ channel blocker (P and Q type)
  • CAS Number: 145017-83-0
  • Soluble in water to 1mg/ml
  • Form / State: Solid
  • Source: Synthetic

You may also be interested in

Doxofylline, Xanthine bronchodilator (ab142296)
Rimantadine hydrochloride, M2 proton channel inhibitor (ab143448)
Goralatide, Hematopoietic progenitor cell cycle inhibitor (ab141185)
Product image
Tertiapin Q, blocker of inward-rectifier r K+ channels (ab120432)

Overview

  • Product name

    omega-Agatoxin IVA, Ca2+ channel blocker (P and Q type)
  • Description

    Ca2+ channel blocker (P and Q type)
  • Biological description

    Synthetic peptide, originally isolated from Agelenopsis aperta spider venom. Selective blocker of Cav2.1 (P/Q type) channels.

  • CAS Number

    145017-83-0
  • Chemical structure

    Chemical Structure

Properties

  • Molecular weight

    5202.25
  • Molecular formula

    C217H360N68O60S10
  • Sequence

    KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA (Modifications: Disulfide bonds: 4-20, 12-25, 19-36, 27-34)
  • PubChem identifier

    56841669
  • Storage instructions

    Store at -20°C. Store under desiccating conditions. The product can be stored for up to 12 months.
  • Solubility overview

    Soluble in water to 1mg/ml
  • Handling

    Wherever possible, you should prepare and use solutions on the same day. However, if you need to make up stock solutions in advance, we recommend that you store the solution as aliquots in tightly sealed vials at -20°C. Generally, these will be useable for up to one week. Before use, and prior to opening the vial we recommend that you allow your product to equilibrate to room temperature for at least 1 hour.

    Need more advice on solubility, usage and handling? Please visit our frequently asked questions (FAQ) page for more details.

  • Source

    Synthetic

  • Research areas

    • Biochemicals
    • Product Range
    • Just Add Water
    • Biochemicals
    • Chemical Type
    • Biochemicals
    • Biochemicals
    • Chemical Type
    • Toxin
    • Biochemicals
    • Chemical Type
    • Bioactive peptides
    • Biochemicals
    • Pharmacology
    • Ion Channels
    • Calcium
    • Blockers
    • Biochemicals
    • Pharmacology
    • Signaling
    • Ca2+ signaling
    • Cav channels
    • Biochemicals
    • Research Area
    • Heart disease
    • Calcium
    • Biochemicals
    • Research Area
    • Heart disease
    • Signaling
    • Ca2+ signaling
    • Cav channels
    • Biochemicals
    • Research Area
    • Pain & inflammation
    • Signaling
    • Ca2+ signaling
    • Cav channels
    • Biochemicals
    • Research Area
    • Alzheimer's Disease
    • Signaling
    • Ca2+ signaling
    • Cav channels
    • Biochemicals
    • Research Area
    • Diabetes
    • Ca2+ signaling
    • Cav channels
    • Biochemicals
    • Research Area
    • Diabetes
    • Signaling
    • Ca2+ signaling
    • Cav channels
    • Biochemicals
    • Research Area
    • Heart disease
    • Ca2+ signaling
    • Cav channels
    • Biochemicals
    • Research Area
    • Hypertension
    • Ca2+ signaling
    • Cav channels
    • Biochemicals
    • Research Area
    • Hypertension
    • Signaling
    • Ca2+ signaling
    • Cav channels
    • Biochemicals
    • Research Area
    • Obesity
    • Ca2+ signaling
    • Cav channels
    • Biochemicals
    • Research Area
    • Obesity
    • Signaling
    • Ca2+ signaling
    • Cav channels
    • Biochemicals
    • Research Area
    • Pain & inflammation
    • Ca2+ signaling
    • Cav channels
    • Biochemicals
    • Research Area
    • Respiratory disease
    • Ca2+ signaling
    • Cav channels
    • Biochemicals
    • Research Area
    • Respiratory disease
    • Signaling
    • Ca2+ signaling
    • Cav channels
    • Biochemicals
    • Research Area
    • Stroke
    • Ca2+ signaling
    • Cav channels
    • Biochemicals
    • Research Area
    • Stroke
    • Signaling
    • Ca2+ signaling
    • Cav channels
    • Biochemicals
    • Research Area
    • Cancer
    • Ca2+ signaling
    • Cav channels

Images

  • Functional Studies - omega-Agatoxin IVA, Ca2+ channel blocker (P and Q type) (ab120210)
    Functional Studies - omega-Agatoxin IVA, Ca2+ channel blocker (P and Q type) (ab120210) Sargoy et al PLoS One. 2014; 9(1): e84507. Reproduced under the Creative Commons license https://creativecommons.org/publicdomain/zero/1.0/

    Many VGCC subtypes contribute to calcium signalling in ganglion cell bodies.

    Summary of Ca2+ imaging results in RGC somata showing the following changes in paired pulse Ca2+ signal in response to drugs (applied during the second K+ pulse) compared to their control paired K+ pulses (K): 10 µM nifedipine (29%±7%; p = 0.0003; n = 20), 100 µM verapamil (VPM; 39%±5%; pω-agatoxin IVA (AGT; 35%±14%; p = 0.0364; n = 9), 3 µM ω-conotoxin-GVIA (CTX; 23%±10%; p = 0.0423; n = 15), 3 µM mibefradil (MIB; 21%±6%; p = 0.0011; n = 16) and 200 nM TTX (40%±9%; p = 0.0004; n = 14).

    (From Figure 7C of Sargoy et al).

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Clear all

Recently viewed products

  •  
  • Product image

    Anti-CTAG1B antibody [EPR13780] - BSA and Azide free (ab225536)

Get resources and offers direct to your inbox Sign up
© 2021 Astana Biomed Group LLP. All rights reserved.