omega-Agatoxin IVA, Ca2+ channel blocker (P and Q type) (ab120210)
Key features and details
- Ca2+ channel blocker (P and Q type)
- CAS Number: 145017-83-0
- Soluble in water to 1mg/ml
- Form / State: Solid
- Source: Synthetic
Overview
-
Product name
omega-Agatoxin IVA, Ca2+ channel blocker (P and Q type) -
Description
Ca2+ channel blocker (P and Q type) -
Biological description
Synthetic peptide, originally isolated from Agelenopsis aperta spider venom. Selective blocker of Cav2.1 (P/Q type) channels.
-
CAS Number
145017-83-0 -
Chemical structure
Properties
-
Molecular weight
5202.25 -
Molecular formula
C217H360N68O60S10 -
Sequence
KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA (Modifications: Disulfide bonds: 4-20, 12-25, 19-36, 27-34) -
PubChem identifier
56841669 -
Storage instructions
Store at -20°C. Store under desiccating conditions. The product can be stored for up to 12 months. -
Solubility overview
Soluble in water to 1mg/ml -
Handling
Wherever possible, you should prepare and use solutions on the same day. However, if you need to make up stock solutions in advance, we recommend that you store the solution as aliquots in tightly sealed vials at -20°C. Generally, these will be useable for up to one week. Before use, and prior to opening the vial we recommend that you allow your product to equilibrate to room temperature for at least 1 hour.
Need more advice on solubility, usage and handling? Please visit our frequently asked questions (FAQ) page for more details.
-
Source
Synthetic
-
Research areas
Images
-
Functional Studies - omega-Agatoxin IVA, Ca2+ channel blocker (P and Q type) (ab120210) Sargoy et al PLoS One. 2014; 9(1): e84507. Reproduced under the Creative Commons license https://creativecommons.org/publicdomain/zero/1.0/
Many VGCC subtypes contribute to calcium signalling in ganglion cell bodies.
Summary of Ca2+ imaging results in RGC somata showing the following changes in paired pulse Ca2+ signal in response to drugs (applied during the second K+ pulse) compared to their control paired K+ pulses (K): 10 µM nifedipine (29%±7%; p = 0.0003; n = 20), 100 µM verapamil (VPM; 39%±5%; pω-agatoxin IVA (AGT; 35%±14%; p = 0.0364; n = 9), 3 µM ω-conotoxin-GVIA (CTX; 23%±10%; p = 0.0423; n = 15), 3 µM mibefradil (MIB; 21%±6%; p = 0.0011; n = 16) and 200 nM TTX (40%±9%; p = 0.0004; n = 14).
(From Figure 7C of Sargoy et al).