Human BNP peptide (ab123777)
Key features and details
- Purity: > 98% SDS-PAGE
- Suitable for: HPLC, SDS-PAGE
-
Product name
Human BNP peptide
See all BNP proteins and peptides -
Purity
> 98 % SDS-PAGE.
Purity is greater than 98% as determined by HPLC and SDS-PAGE. -
Accession
-
Animal free
No -
Nature
Synthetic -
-
Species
Human -
Sequence
SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH-OH -
Predicted molecular weight
3 kDa including tags -
Amino acids
103 to 134
-
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at -20ºC.
-
ReconstitutionCentrifuge the vial prior to opening. Reconstitute in sterile H2O to a concentration = 100 µg/ml. This solution can then be diluted into other aqueous buffers. Reconstituted ab123777 should be stored at 4°C for 2-7 days and at -20°C for future use. For long term storage it is recommended to add a carrier protein (0.1 % HSA or BSA) and store as working aliquots at -20°C.
