Charybdotoxin, K+ channel blocker (ab120269)
Key features and details
- K+ channel blocker
- CAS Number: 95751-30-7
- Soluble in water
- Form / State: Solid
- Source: Synthetic
Overview
-
Product name
Charybdotoxin, K+ channel blocker -
Description
K+ channel blocker -
Biological description
Blocks KCa1.1 (large conductance Ca2+ activated K+, Slo) channels in nanomolar concentrations as well as Kv1.2 (Kd = 14 nM) and Kv1.3 (Kd = 2.6 nM) channels.
-
CAS Number
95751-30-7 -
Chemical structure

Properties
-
Molecular weight
4295.89 -
Molecular formula
C176H277N57O55S7 -
Sequence
XFTNVSCTTSKECWSVCQRLHNTSRGKCMNKKCRCYS (Modifications: X-1 = Glp; Disulfide bonds: 7-28, 13-33, 17-35) -
PubChem identifier
56842037 -
Storage instructions
Store at -20°C. Store under desiccating conditions. The product can be stored for up to 12 months. -
Solubility overview
Soluble in water -
Handling
Wherever possible, you should prepare and use solutions on the same day. However, if you need to make up stock solutions in advance, we recommend that you store the solution as aliquots in tightly sealed vials at -20°C. Generally, these will be useable for up to one week. Before use, and prior to opening the vial we recommend that you allow your product to equilibrate to room temperature for at least 1 hour.
Need more advice on solubility, usage and handling? Please visit our frequently asked questions (FAQ) page for more details.
-
Source
Synthetic
-
Research areas