Anti-XRCC2 antibody (ab180752)
Key features and details
- Rabbit polyclonal to XRCC2
- Suitable for: ICC/IF, WB, IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-XRCC2 antibody
See all XRCC2 primary antibodies -
Description
Rabbit polyclonal to XRCC2 -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IF, WB, IHC-Pmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat -
Immunogen
Recombinant full length protein corresponding to Human XRCC2 aa 1-280.
Sequence:MCSAFHRAESGTELLARLEGRSSLKEIEPNLFADEDSPVHGDILEFHGPE GTGKTEMLYHLTARCILPKSEGGLEVEVLFIDTDYHFDMLRLVTILEHRL SQSSEEIIKYCLGRFFLVYCSSSTHLLLTLYSLESMFCSHPSLCLLILDS LSAFYWIDRVNGGESVNLQESTLRKCSQCLEKLVNDYRLVLFATTQTIMQ KASSSSEEPSHASRRLCDVDIDYRPYLCKAWQQLVKHRMFFSKQDDSQSS NQFSLVSRCLKSNSLKKHFFIIGESGVEFC
Database link: O43543 -
Positive control
- Extracts of HeLa, SH-SY5Y and SW480 cells.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.30
Preservative: 0.02% Sodium azide
Constituents: 49% PBS, 50% Glycerol -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Images
-
All lanes : Anti-XRCC2 antibody (ab180752) at 1/500 dilution
Lane 1 : Extracts of HeLa cell line
Lane 2 : Extracts of SH-SY5Y cell line
Lane 3 : Extracts of SW480 cell line
Predicted band size: 32 kDa
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human thyroid cancer tissue labelling XRCC2 with ab180752 at a dilution of 1/50.
-
Immunocytochemistry/Immunofluorescence analysis of A549 cells labeling XRCC2 with ab180752 (shown in green) at a dilution of 1/50. Nuclear DNA was labelled with DAPI (shown in blue).
-
Immunocytochemistry/Immunofluorescence analysis of A549 cells labeling XRCC2 with ab180752 (shown in green) at a dilution of 1/50.
-
Immunocytochemistry/Immunofluorescence analysis of MCF7 cells using ab180752. Blue DAPI for nuclear staining.