Anti-VGLUT3 antibody [N34/34] (ab134310)
Key features and details
- Mouse monoclonal [N34/34] to VGLUT3
- Suitable for: ICC/IF
- Reacts with: Human
- Isotype: IgG1
Overview
-
Product name
Anti-VGLUT3 antibody [N34/34] -
Description
Mouse monoclonal [N34/34] to VGLUT3 -
Host species
Mouse -
Tested applications
Suitable for: ICC/IFmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat -
Immunogen
Fusion protein (His-tag) corresponding to Rat VGLUT3 aa 546-588 (C terminal).
Sequence:MSYGATTQNCEVQKTDRRQQRESAFEGEEPLSYQNEEDFSETS
Database link: Q7TSF2 -
Positive control
- ICC/IF: SK-N-BE cells.
-
General notes
The clone number has been updated from S34-34 to N34/34, both clone numbers name the same antibody clone.
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at -20°C. Stable for 12 months at -20°C. -
Storage buffer
Preservative: 0.09% Sodium azide
Constituents: PBS, 50% Glycerol (glycerin, glycerine) -
Concentration information loading...
-
Purity
Protein G purified -
Clonality
Monoclonal -
Clone number
N34/34 -
Isotype
IgG1 -
Research areas
Images
-
Immunocytochemistry/Immunofluorescence analysis of SK-N-BE (Human neuroblastoma cell line) cells labeling VGLUT3 using ab134310 at 1/100 for 60 minutes at RT. Cells were fixed in 4% formaldehyde for 15 minutes at RT. Secondary Antibody: Goat Anti-Mouse ATTO 488 at 1/200 for 60 min at RT. Counterstain: Phalloidin Texas Red F-Actin stain; DAPI (blue) nuclear stain at 1/1000, 1/5000 for 60 min at RT, 5 min at RT.