Anti-TLR8 antibody (ab180610)
Key features and details
- Rabbit polyclonal to TLR8
- Suitable for: WB, ICC/IF
- Reacts with: Mouse, Rat
- Isotype: IgG
Overview
-
Product name
Anti-TLR8 antibody
See all TLR8 primary antibodies -
Description
Rabbit polyclonal to TLR8 -
Host species
Rabbit -
Tested applications
Suitable for: WB, ICC/IFmore details -
Species reactivity
Reacts with: Mouse, Rat -
Immunogen
Recombinant fragment corresponding to Human TLR8 aa 849-1041.
Sequence:HHLFYWDVWFIYNVCLAKVKGYRSLSTSQTFYDAYISYDTKDASVTDWVI NELRYHLEESRDKNVLLCLEERDWDPGLAIIDNLMQSINQSKKTVFVLTK KYAKSWNFKTAFYLALQRLMDENMDVIIFILLEPVLQHSQYLRLRQRICK SSILQWPDNPKAEGLFWQTLRNVVLTENDSRYNNMYVDSIKQY
Database link: Q9NR97 -
Positive control
- WB: Mouse liver tissue lysate; ICC/ IF: Mouse and rat spleen.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.30
Preservative: 0.02% Sodium azide
Constituents: 49% PBS, 50% Glycerol -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Images
-
Immunofluorescence staining of mouse spleen tissue stained for TLR8 with ab180610 at 1/100 dilution. Nuclei are labeled with DAPI (Blue).
-
Anti-TLR8 antibody (ab180610) at 1/1000 dilution + Mouse liver tissue lysate at 25 µg
Secondary
HRP Goat AntiRabbit IgG (H+L)
Developed using the ECL technique.
Predicted band size: 120 kDaBlocking buffer: 3% nonfat dry milk in TBST.
-
Immunofluorescence staining of rat spleen tissue stained for TLR8 with ab180610 at 1/100 dilution. Nuclei are labeled with DAPI (Blue).