Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category
Cardiovascular Atherosclerosis Thrombosis Platelets

Anti-TFPI antibody (ab180619)

Price and availability

278 083 ₸

Availability

Order now and get it on Wednesday February 24, 2021

Anti-TFPI antibody (ab180619)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)

Key features and details

  • Rabbit polyclonal to TFPI
  • Suitable for: WB, IHC-P, ICC/IF
  • Reacts with: Mouse, Human
  • Isotype: IgG

You may also be interested in

Product image
Anti-Thromboxane A2 receptor/TBXA2R antibody [EPR7336] (ab134959)
Recombinant human PDGF AA protein (ab9702)
Anti-Platelet antibody [AIP21] (ab112238)
Product image
Anti-CD31 antibody [EPR17260-265] - BSA and Azide free (ab232227)

Overview

  • Product name

    Anti-TFPI antibody
    See all TFPI primary antibodies
  • Description

    Rabbit polyclonal to TFPI
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment corresponding to Human TFPI aa 29-224.
    Sequence:

    DSEEDEEHTIITDTELPPLKLMHSFCAFKADDGPCKAIMKRFFFNIFTRQ CEEFIYGGCEGNQNRFESLEECKKMCTRDNANRIIKTTLQQEKPDFCFLE EDPGICRGYITRYFYNNQTKQCERFKYGGCLGNMNNFETLEECKNICEDG PNGFQVDNYGTQLNAVNNSLTPQSTKVPSLFEFHGPSWCLTPADRG


    Database link: P10646
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • HepG2 and HeLa cell line extracts.
  • General notes

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.30
    Preservative: 0.02% Sodium azide
    Constituents: 50% Glycerol, 49% PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

    • Cardiovascular
    • Blood
    • Platelets
    • Cardiovascular
    • Blood
    • Coagulation
    • Extrinsic

Images

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-TFPI antibody (ab180619)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-TFPI antibody (ab180619)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of mouse kidney tissue labelling TFPI with ab180619 at 1/100. Magnification: 200x.
  • Western blot - Anti-TFPI antibody (ab180619)
    Western blot - Anti-TFPI antibody (ab180619)
    All lanes : Anti-TFPI antibody (ab180619) at 1/500 dilution

    Lane 1 : 293T cell lysate
    Lane 2 : MCF-7 cell lysate
    Lane 3 : Mouse lung tissue lysate
    Lane 4 : Mouse heart tissue lysate
    Lane 5 : Mouse spleen tissue lysate

    Predicted band size: 35 kDa

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-TFPI antibody (ab180619)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-TFPI antibody (ab180619)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human liver cancer tissue labelling TFPI with ab180619 at 1/100. Magnification: 200x.
  • Immunocytochemistry/ Immunofluorescence - Anti-TFPI antibody (ab180619)
    Immunocytochemistry/ Immunofluorescence - Anti-TFPI antibody (ab180619)
    Immunocytochemistry/Immunofluorescence analysis of MCF7 cells using ab180619. Blue DAPI for nuclear staining.
  • Western blot - Anti-TFPI antibody (ab180619)
    Western blot - Anti-TFPI antibody (ab180619)
    All lanes : Anti-TFPI antibody (ab180619) at 1/500 dilution

    Lane 1 : HepG2 cell line extract
    Lane 2 : HeLa cell line extract

    Predicted band size: 35 kDa

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Alternative products to Anti-TFPI antibody (ab180619)

  •  
  • Product image

    Anti-TFPI antibody (ab181392)

    Applications: ICC/IF, IHC-P, WB

  •  
  • Product image

    Anti-TFPI antibody [C1] (ab239516)

    Applications: IHC-P, WB

  •  
  • Product image

    Anti-TFPI antibody [EPR7941] (ab134151)

    Applications: WB

  •  
  • Product image

    Anti-TFPI antibody (ab66544)

    Applications: WB

Clear all

Recently viewed products

  •  
  • Product image

    Anti-CXCR6 antibody (ab8023)

  •  
  • Product image

    Anti-STK19/G11 antibody (ab251814)

Get resources and offers direct to your inbox Sign up
© 2021 Astana Biomed Group LLP. All rights reserved.