Anti-TFPI antibody (ab180619)
Key features and details
- Rabbit polyclonal to TFPI
- Suitable for: WB, IHC-P, ICC/IF
- Reacts with: Mouse, Human
- Isotype: IgG
Overview
-
Product name
Anti-TFPI antibody
See all TFPI primary antibodies -
Description
Rabbit polyclonal to TFPI -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-P, ICC/IFmore details -
Species reactivity
Reacts with: Mouse, Human -
Immunogen
Recombinant fragment corresponding to Human TFPI aa 29-224.
Sequence:DSEEDEEHTIITDTELPPLKLMHSFCAFKADDGPCKAIMKRFFFNIFTRQ CEEFIYGGCEGNQNRFESLEECKKMCTRDNANRIIKTTLQQEKPDFCFLE EDPGICRGYITRYFYNNQTKQCERFKYGGCLGNMNNFETLEECKNICEDG PNGFQVDNYGTQLNAVNNSLTPQSTKVPSLFEFHGPSWCLTPADRG
Database link: P10646 -
Positive control
- HepG2 and HeLa cell line extracts.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.30
Preservative: 0.02% Sodium azide
Constituents: 50% Glycerol, 49% PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-TFPI antibody (ab180619)Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of mouse kidney tissue labelling TFPI with ab180619 at 1/100. Magnification: 200x.
-
All lanes : Anti-TFPI antibody (ab180619) at 1/500 dilution
Lane 1 : 293T cell lysate
Lane 2 : MCF-7 cell lysate
Lane 3 : Mouse lung tissue lysate
Lane 4 : Mouse heart tissue lysate
Lane 5 : Mouse spleen tissue lysate
Predicted band size: 35 kDa
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-TFPI antibody (ab180619)Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human liver cancer tissue labelling TFPI with ab180619 at 1/100. Magnification: 200x.
-
Immunocytochemistry/Immunofluorescence analysis of MCF7 cells using ab180619. Blue DAPI for nuclear staining.
-
All lanes : Anti-TFPI antibody (ab180619) at 1/500 dilution
Lane 1 : HepG2 cell line extract
Lane 2 : HeLa cell line extract
Predicted band size: 35 kDa