Anti-Synaptotagmin VII antibody [N275/14] (ab174633)
Key features and details
- Mouse monoclonal [N275/14] to Synaptotagmin VII
- Suitable for: IHC-P, IHC-Fr, ICC/IF, WB
- Reacts with: Rat, Human
- Isotype: IgG2b
Overview
-
Product name
Anti-Synaptotagmin VII antibody [N275/14]
See all Synaptotagmin VII primary antibodies -
Description
Mouse monoclonal [N275/14] to Synaptotagmin VII -
Host species
Mouse -
Tested Applications & Species
See all applications and species dataApplication Species ICC/IF HumanWB Rat -
Immunogen
Fusion protein corresponding to Mouse Synaptotagmin VII aa 150-239 (internal sequence).
Sequence:STLTVKVMKAQELPAKDFSGTSDPFVKIYLLPDKKHKLETKVKRKNLNPH WNETFLFEGFPYEKVVQRVLYLQVLDYDRFSRNDPIGEVS
Database link: Q9R0N7 -
Epitope
Cytoplasmic C2A domain -
Positive control
- WB: Rat brain lysate.
-
General notes
Abcam is committed to ensuring that our customers have access to all of the information we have on our products and that the product information is accurate. The clone name for this product was previously known as S27514. However, it has come to our attention that the original and primary clone name is N275/14 so we have therefore changed the product name accordingly.
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing the problem with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation.
One factor contributing to the crisis is the use of antibodies that are not suitable. This can lead to misleading results and the use of incorrect data informing project assumptions and direction. To help address this challenge, we have introduced an application and species grid on our primary antibody datasheets to make it easy to simplify identification of the right antibody for your needs.
Learn more here.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.09% Sodium azide
Constituents: PBS, 50% Glycerol -
Concentration information loading...
-
Purity
Protein G purified -
Clonality
Monoclonal -
Clone number
N275/14 -
Isotype
IgG2b -
Research areas
Images
-
Immunocytochemistry/Immunofluorescence analysis using ab174633 at 1:100 in Neuroblastoma cell line (SK-N-BE) Fixation: 4% Formaldehyde for 15 min at RT. Primary Antibody incubaitionfor 60 min at RT. Secondary Antibody: Goat Anti-Mouse ATTO 488 at 1:100 for 60 min at RT. Counterstain: Phalloidin Texas Red F-Actin stain at 1:1000 for 60 min RT; DAPI (blue) nuclear stain at 1:5000 for 5 min RT. Magnification: 60X. (A) DAPI (blue) nuclear stain. (B) Phalloidin Texas Red F-Actin stain. (C) ab174633 (D) Composite.
-
Lane 1 : Anti-Synaptotagmin VII antibody [N275/14] (ab174633) at 1/100 dilution
Lane 2 : Anti-Synaptotagmin VII antibody [N275/14] (ab174633) at 1/250 dilution
Lane 3 : Anti-Synaptotagmin VII antibody [N275/14] (ab174633) at 1/500 dilution
Lane 4 : Anti-Synaptotagmin VII antibody [N275/14] (ab174633) at 1/1000 dilution
All lanes : Rat brain lysates
Predicted band size: 45 kDa
Additional bands at: 65 kDa (possible isoform)