Anti-sPLA2-IIE antibody (ab169045)
Key features and details
- Mouse polyclonal to sPLA2-IIE
- Suitable for: WB
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-sPLA2-IIE antibody
See all sPLA2-IIE primary antibodies -
Description
Mouse polyclonal to sPLA2-IIE -
Host species
Mouse -
Tested Applications & Species
See all applications and species dataApplication Species WB Human -
Immunogen
Full length protein corresponding to Human sPLA2-IIE aa 1-142.
Sequence:MKSPHVLVFLCLLVALVTGNLVQFGVMIEKMTGKSALQYNDYGCYCGIGG SHWPVDQTDWCCHAHDCCYGRLEKLGCEPKLEKYLFSVSERGIFCAGRTT CQRLTCECDKRAALCFRRNLGTYNRKYAHYPNKLCTGPTPPC
-
Positive control
- sPLA2-IIE transfected 293T cell lysate.
-
General notes
Previously labelled as Phospholipase A2 IIE.
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. -
Storage buffer
pH: 7.4
Constituent: 99% PBS -
Concentration information loading... -
Purity
Protein A purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Images
-
All lanes : Anti-sPLA2-IIE antibody (ab169045) at 1 µg/ml
Lane 1 : sPLA2-IIE transfected 293T cell lysate
Lane 2 : non transfected 293T cell lysate
Lysates/proteins at 15 µl per lane.
Secondary
All lanes : Goat anti-mouse HRP conjugated antibody at 1/2500 dilution
Developed using the ECL technique.
Predicted band size: 16 kDa

