Anti-SPCS2/SPC25 antibody (ab121395)
Key features and details
- Rabbit polyclonal to SPCS2/SPC25
- Suitable for: ICC/IF, WB, IHC-P
- Reacts with: Mouse, Rat, Human
- Isotype: IgG
Overview
-
Product name
Anti-SPCS2/SPC25 antibody
See all SPCS2/SPC25 primary antibodies -
Description
Rabbit polyclonal to SPCS2/SPC25 -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IF, WB, IHC-Pmore details -
Species reactivity
Reacts with: Mouse, Rat, Human -
Immunogen
Recombinant fragment corresponding to Human SPCS2/SPC25 aa 2-65.
Sequence:AAAAVQGGRSGGSGGCSGAGGASNCGTGSGRSGLLDKWKIDDKPVKIDKW DGSAVKNSLDDSAK
Database link: Q15005 -
Positive control
- WB: RT-4, U-251 MG, Human liver and tonsil; mouse NIH/3T3, rat NBT-II cells; IHC-P: Human epididymis, pancreas, colon, lymph node, cerebral cortex tissues; ICC/IF: human cell line U-2 OS
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 59% PBS, 40% Glycerol (glycerin, glycerine) -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Images
-
Immunocytochemistry/ Immunofluorescence - Anti-SPCS2/SPC25 antibody (ab121395)
Immunocytochemistry/immunofluorescence analysis of human cell line U-2 OS labelling SPCS2/SPC25 with ab121395 at 2 µg/mL
-
Western blot - Anti-SPCS2/SPC25 antibody (ab121395)All lanes : Anti-SPCS2/SPC25 antibody (ab121395) at 1/250 dilution
Lane 1 : RT-4
Lane 2 : U-251 MG
Lane 3 : Human plasma
Lane 4 : Human liver
Lane 5 : Human tonsil
Developed using the ECL technique.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SPCS2/SPC25 antibody (ab121395)ab121395, at a 1/50 dilution, staining SPCS2/SPC25 in paraffin embedded Human testis tissue by Immunohistochemistry.
