Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category
Epigenetics and Nuclear Signaling Transcription Domain Families HMG Box

Anti-SOX17 antibody (ab155402)

Anti-SOX17 antibody (ab155402)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)

Key features and details

  • Rabbit polyclonal to SOX17
  • Suitable for: WB, IHC-P
  • Reacts with: Mouse, Human
  • Isotype: IgG

You may also be interested in

Product image
Alexa Fluor® 647 Anti-LEF1 antibody [EPR2029Y] (ab246715)
Product image
Anti-SOX9 antibody - BSA and Azide free (Detector) (ab252658)
Product image
Alexa Fluor® 488 Anti-SOX9 antibody [EPR12755] (ab202686)
Product image
Anti-SOX9 antibody [EPR12755] (ab182579)

Overview

  • Product name

    Anti-SOX17 antibody
    See all SOX17 primary antibodies
  • Description

    Rabbit polyclonal to SOX17
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Zebrafish
  • Immunogen

    Synthetic peptide corresponding to Human SOX17 aa 70-120.
    Sequence:

    RPMNAFMVWAKDERKRLAQQNPDLHNAELSKMLGKSWKALTLAEKRPFVE E


    Database link: Q9H6I2
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • Human uterus tissue, Human testis tissue, Mouse embryo brain lysate
  • General notes

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage buffer

    Preservative: 0.05% Sodium azide
    Constituents: 0.05% BSA, 99% PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

    • Epigenetics and Nuclear Signaling
    • Transcription
    • Domain Families
    • HMG Box
    • Stem Cells
    • Embryonic Stem Cells
    • Intracellular
    • Epigenetics and Nuclear Signaling
    • Transcription
    • Transcription Factors
    • Developmental Biology
    • Embryogenesis
    • Embryonic stem cells
    • Surface molecules

Images

  • Western blot - Anti-SOX17 antibody (ab155402)
    Western blot - Anti-SOX17 antibody (ab155402)
    All lanes : Anti-SOX17 antibody (ab155402) at 1 µg/ml

    Lane 1 : Mouse embryo brain lysate
    Lane 2 : Mouse embryo brain lysate with immunizing peptide

    Secondary
    All lanes : Goat anti-rabbit Ig HRP

    Developed using the ECL technique.

    Predicted band size: 44 kDa

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SOX17 antibody (ab155402)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SOX17 antibody (ab155402)
    Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human uterus tissue labeling SOX17 using ab155402 at 10 &microg/ml.
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SOX17 antibody (ab155402)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SOX17 antibody (ab155402)
    Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human testis tissue labeling SOX17 using ab155402 at 10 &microg/ml.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Alternative products to Anti-SOX17 antibody (ab155402)

  •  
  • Product image

    Anti-SOX17 antibody (ab191699)

    Applications: ICC/IF, WB

  •  
  • Product image

    Anti-SOX17 antibody [EPR20684] - BSA and Azide free (ab226862)

    Applications: IHC-P, IP, WB

  •  
  • Product image

    Anti-SOX17 antibody [OTI3B10] (ab84990)

    Applications: Flow Cyt, ICC/IF

  •  
  • Product image

    Anti-SOX17 antibody [EPR20684] (ab224637)

    Applications: IHC-P, IP, WB

  •  
  • Product image

    Anti-SOX17 antibody (ab99370)

    Applications: WB

Clear all

Recently viewed products

  •  
  • Product image

    Anti-IGF1 antibody (ab106836)

  •  
  • Product image

    Anti-COG7 antibody (ab187861)

  •  
  • Product image

    Anti-TRIP6 antibody (ab137478)

  •  
  • Product image

    Anti-H2R antibody (ab215992)

  •  
  • Product image

    Anti-EMX2 antibody (ab110112)

  •  
  • Product image

    Anti-IFNAR2 antibody (ab204126)

Get resources and offers direct to your inbox Sign up
© 2021 Astana Biomed Group LLP. All rights reserved.