Anti-SOX17 antibody (ab155402)
Key features and details
- Rabbit polyclonal to SOX17
- Suitable for: WB, IHC-P
- Reacts with: Mouse, Human
- Isotype: IgG
Overview
-
Product name
Anti-SOX17 antibody
See all SOX17 primary antibodies -
Description
Rabbit polyclonal to SOX17 -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Mouse, Human
Predicted to work with: Zebrafish -
Immunogen
Synthetic peptide corresponding to Human SOX17 aa 70-120.
Sequence:RPMNAFMVWAKDERKRLAQQNPDLHNAELSKMLGKSWKALTLAEKRPFVE E
Database link: Q9H6I2 -
Positive control
- Human uterus tissue, Human testis tissue, Mouse embryo brain lysate
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. -
Storage buffer
Preservative: 0.05% Sodium azide
Constituents: 0.05% BSA, 99% PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Images
-
All lanes : Anti-SOX17 antibody (ab155402) at 1 µg/ml
Lane 1 : Mouse embryo brain lysate
Lane 2 : Mouse embryo brain lysate with immunizing peptide
Secondary
All lanes : Goat anti-rabbit Ig HRP
Developed using the ECL technique.
Predicted band size: 44 kDa
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SOX17 antibody (ab155402)Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human uterus tissue labeling SOX17 using ab155402 at 10 µg/ml.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SOX17 antibody (ab155402)Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human testis tissue labeling SOX17 using ab155402 at 10 µg/ml.