Anti-SLC51B antibody (ab121285)
Key features and details
- Rabbit polyclonal to SLC51B
- Suitable for: WB, IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-SLC51B antibody
See all SLC51B primary antibodies -
Description
Rabbit polyclonal to SLC51B -
Host species
Rabbit -
Tested Applications & Species
See all applications and species dataApplication Species IHC-P HumanWB Human
-
Immunogen
Recombinant fragment corresponding to Human SLC51B aa 77-127.
Sequence:VLHLDEAKDHNSLNNLRETLLSEKPNLAQVELELKERDVLSVFLPDVPET E
Database link: Q86UW2 -
Positive control
- WB: Caco-2 cell lysate. IHC-P: Human small intestine, testis and kidney tissue.
-
General notes
This product was previously labelled as OST-beta
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: PBS, 40% Glycerol (glycerin, glycerine) -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SLC51B antibody (ab121285)Immunohistochemical analysis of human testis tissue labeling OST beta with ab121285 at 1/50 dilution.
-
Western blot - Anti-SLC51B antibody (ab121285)All lanes : Anti-SLC51B antibody (ab121285) at 0.4 µg/ml
Lane 1 : Caco-2 (Human colorectal adenocarcinoma cell line) cell lysate
Lane 2 : U-2 OS (Human bone osteosarcoma epithelial cell line) cell lysate
Observed band size: 14 kDa why is the actual band size different from the predicted?
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SLC51B antibody (ab121285)Immunohistochemical analysis of human kidney tissue labeling OST beta with ab121285 at 1/50 dilution. -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SLC51B antibody (ab121285)Immunohistochemical analysis of human liver tissue labeling OST beta with ab121285 at 1/50 dilution. This showes no positivity as expected. -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SLC51B antibody (ab121285)Immunohistochemical analysis of human small intestine tissue labeling OST beta with ab121285 at 1/50 dilution.
