Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category
Cell Biology Other Antibodies

Anti-SETD3 antibody (ab176582)

Anti-SETD3 antibody (ab176582)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)

Key features and details

  • Rabbit polyclonal to SETD3
  • Suitable for: WB, IP
  • Reacts with: Mouse, Human
  • Isotype: IgG

You may also be interested in

Product image
Recombinant Human NRN1L protein (Fc Chimera) (ab276593)
Product image
Anti-C20orf112/NOL4L antibody (ab237758)
Product image
Recombinant Human ZCCHC3 protein (ab164746)
Product image
Anti-CSC1 antibody [EPR19814] - BSA and Azide free (ab251395)

Overview

  • Product name

    Anti-SETD3 antibody
  • Description

    Rabbit polyclonal to SETD3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IPmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rat, Rabbit, Horse, Chicken, Cow, Dog, Pig, Zebrafish, Rhesus monkey, Xenopus tropicalis
  • Immunogen

    Synthetic peptide within Human SETD3 aa 1-50 (N terminal). The exact sequence is proprietary.
    Sequence:

    MGKKSRVKTQKSGTGATATVSPKEILNLTSELLQKCSSPAPGPGKEWEEY


    Database link: Q86TU7
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • Jurkat, HeLa, 293T, mouse TCMK1 and mouse NIH 3T3 whole cell lysates.
  • General notes

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7
    Preservative: 0.09% Sodium azide
    Constituent: 99% Tris citrate/phosphate

    pH 7-8
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab176582 was affinity purified using an epitope specific to SETD3 immobilized on solid support.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

    • Cell Biology
    • Other Antibodies
    • Other Antibodies

Images

  • Immunoprecipitation - Anti-SETD3 antibody (ab176582)
    Immunoprecipitation - Anti-SETD3 antibody (ab176582)

    Detection of SETD3 by Western Blot of Immunprecipitate.
    Anti-SETD3 antibody at 1µg/ml labeling SETD3 in Jurkat whole cell lysate (1 mg/IP; 20% of IP loaded) immunoprecipitated using ab176582 at 6µg/mg lysate.

    Detection: Chemiluminescence with exposure time of 30 seconds.

  • Western blot - Anti-SETD3 antibody (ab176582)
    Western blot - Anti-SETD3 antibody (ab176582)
    All lanes : Anti-SETD3 antibody (ab176582) at 0.1 µg/ml

    Lane 1 : Jurkat whole cell lysate
    Lane 2 : HeLa whole cell lysate
    Lane 3 : 293T whole cell lysate
    Lane 4 : Mouse TCMK1 whole cell lysate
    Lane 5 : Mouse NIH3T3 whole cell lysate

    Lysates/proteins at 50 µg per lane.

    Developed using the ECL technique.

    Predicted band size: 67 kDa


    Exposure time: 1 minute

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Clear all

Recently viewed products

  •  
  • Product image

    Anti-PTS/PTPS antibody (ab96104)

  •  
  • Product image

    Anti-MCAK antibody (ab71706)

  •  
  • Product image

    Anti-GM-CSF antibody (ab9741)

  •  
  • Product image

    Anti-MGP antibody (ab224367)

  •  
  • Product image

    Recombinant Human MG53 protein (ab132761)

  •  
  • Product image

    Human Endostatin ELISA Kit (ab100508)

Get resources and offers direct to your inbox Sign up
© 2021 Astana Biomed Group LLP. All rights reserved.