Anti-SETD3 antibody (ab176582)
Key features and details
- Rabbit polyclonal to SETD3
- Suitable for: WB, IP
- Reacts with: Mouse, Human
- Isotype: IgG
Overview
-
Product name
Anti-SETD3 antibody -
Description
Rabbit polyclonal to SETD3 -
Host species
Rabbit -
Tested applications
Suitable for: WB, IPmore details -
Species reactivity
Reacts with: Mouse, Human
Predicted to work with: Rat, Rabbit, Horse, Chicken, Cow, Dog, Pig, Zebrafish, Rhesus monkey, Xenopus tropicalis -
Immunogen
Synthetic peptide within Human SETD3 aa 1-50 (N terminal). The exact sequence is proprietary.
Sequence:MGKKSRVKTQKSGTGATATVSPKEILNLTSELLQKCSSPAPGPGKEWEEY
Database link: Q86TU7 -
Positive control
- Jurkat, HeLa, 293T, mouse TCMK1 and mouse NIH 3T3 whole cell lysates.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7
Preservative: 0.09% Sodium azide
Constituent: 99% Tris citrate/phosphate
pH 7-8 -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Purification notes
ab176582 was affinity purified using an epitope specific to SETD3 immobilized on solid support. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Images
-
Detection of SETD3 by Western Blot of Immunprecipitate.
Anti-SETD3 antibody at 1µg/ml labeling SETD3 in Jurkat whole cell lysate (1 mg/IP; 20% of IP loaded) immunoprecipitated using ab176582 at 6µg/mg lysate.Detection: Chemiluminescence with exposure time of 30 seconds.
-
All lanes : Anti-SETD3 antibody (ab176582) at 0.1 µg/ml
Lane 1 : Jurkat whole cell lysate
Lane 2 : HeLa whole cell lysate
Lane 3 : 293T whole cell lysate
Lane 4 : Mouse TCMK1 whole cell lysate
Lane 5 : Mouse NIH3T3 whole cell lysate
Lysates/proteins at 50 µg per lane.
Developed using the ECL technique.
Predicted band size: 67 kDa
Exposure time: 1 minute