Anti-SENP2 antibody [OTI1H2] (ab131637)
Key features and details
- Mouse monoclonal [OTI1H2] to SENP2
- Suitable for: WB, IHC-P, Flow Cyt, ICC/IF
- Reacts with: Human, African green monkey
- Isotype: IgG1
Overview
-
Product name
Anti-SENP2 antibody [OTI1H2]
See all SENP2 primary antibodies -
Description
Mouse monoclonal [OTI1H2] to SENP2 -
Host species
Mouse -
Tested Applications & Species
See all applications and species dataApplication Species Flow Cyt HumanICC/IF African green monkeyIHC-P HumanWB Human -
Immunogen
Recombinant fragment corresponding to Human SENP2 aa 139-523. Produced in E.coli (NP_067640).
Sequence:RDQPRRVLPSFGFTLNSEGCNRRPGGRRHSKGNPESSLMWKPQEQAVTEM ISEESGKGLRRPHCTVEEGVQKEEREKYRKLLERLKESGHGNSVCPVTSN YHSSQRSQMDTLKTKGWGEEQNHGVKTTQFVPKQYRLVETRGPLCSLRSE KRCSKGKITDTETMVGIRFENESRRGYQLEPDLSEEVSARLRLGSGSNGL LRRKVSIIETKEKNCSGKERDRRTDDLLELTEDMEKEISNALGHGPQDEI LSSAFKLRITRGDIQTLKNYHWLNDEVINFYMNLLVERNKKQGYPALHVF STFFYPKLKSGGYQAVKRWTKGVNLFEQEIILVPIHRKVHWSLVVIDLRK KCLKYLDSMGQKGHRICEILLQYLQDESKTKRNSD
Database link: Q9HC62 -
Positive control
- WB: HEK-293T cells transfected with pCMV6-ENTRY SENP2 cDNA. IHC-P: Human prostate carcinoma, prostate, endometrium adenocarcinoma, pancreas carcinoma, pancreas, ovary adenocarcinoma, lung carcinoma and kidney tissues. Flow Cyt: HeLa and Jurkat cells. ICC/IF: COS-7 cells transiently transfected by pCMV6-ENTRY SENP2.
-
General notes
Clone OTI1H2 (formerly 1H2).
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing the problem with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation.
One factor contributing to the crisis is the use of antibodies that are not suitable. This can lead to misleading results and the use of incorrect data informing project assumptions and direction. To help address this challenge, we have introduced an application and species grid on our primary antibody datasheets to make it easy to simplify identification of the right antibody for your needs.
Learn more here.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.30
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol, 1% BSA -
Concentration information loading... -
Purity
Affinity purified -
Purification notes
Purified from cell culture supernatant by affinity chromatography. -
Clonality
Monoclonal -
Clone number
OTI1H2 -
Isotype
IgG1 -
Research areas
Images
-
All lanes : Anti-SENP2 antibody [OTI1H2] (ab131637) at 1/2000 dilution
Lane 1 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate transfected with the pCMV6-ENTRY control cDNA
Lane 2 : HEK-293T cell lysate transfected with pCMV6-ENTRY SENP2 cDNA
Lysates/proteins at 5 µg per lane.
Predicted band size: 68 kDa
-
COS-7 (african green monkey kidney fibroblast-like cell line) cells transiently transfected by pCMV6-ENTRY SENP2 stained for SENP2 (green) using ab131637 at 1/100 dilution in ICC/IF.
-
Flow cytometric analysis of HeLa (human epithelial cell line from cervix adenocarcinoma) cells labeling SENP2 with ab131637 at 1/100 dilution (Red) compared to a nonspecific negative control antibody (Blue).
-
Flow cytometric analysis of Jurkat (human T cell leukemia cell line from peripheral blood) cells labeling SENP2 with ab131637 at 1/100 dilution (Red) compared to a nonspecific negative control antibody (Blue).
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SENP2 antibody [OTI1H2] (ab131637)Paraffin-embedded human kidney tissue stained for SENP2 using ab131637 at 1/50 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SENP2 antibody [OTI1H2] (ab131637)Paraffin-embedded human lung carcinoma tissue stained for SENP2 using ab131637 at 1/50 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SENP2 antibody [OTI1H2] (ab131637)Paraffin-embedded human ovary adenocarcinoma tissue stained for SENP2 using ab131637 at 1/50 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SENP2 antibody [OTI1H2] (ab131637)Paraffin-embedded human pancreas carcinoma tissue stained for SENP2 using ab131637 at 1/50 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SENP2 antibody [OTI1H2] (ab131637)Paraffin-embedded human pancreas tissue stained for SENP2 using ab131637 at 1/50 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SENP2 antibody [OTI1H2] (ab131637)Paraffin-embedded human endometrium adenocarcinoma tissue stained for SENP2 using ab131637 at 1/50 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SENP2 antibody [OTI1H2] (ab131637)Paraffin-embedded human prostate tissue stained for SENP2 using ab131637 at 1/50 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SENP2 antibody [OTI1H2] (ab131637)Paraffin-embedded human prostate carcinoma tissue stained for SENP2 using ab131637 at 1/50 dilution in immunohistochemical analysis.

