Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category
Cell Biology Proteolysis / Ubiquitin Proteasome / Ubiquitin Sumo

Anti-SENP2 antibody [OTI1H2] (ab131637)

Price and availability

274 732 ₸

Availability

Order now and get it on Thursday March 04, 2021

Anti-SENP2 antibody [OTI1H2] (ab131637)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)

Key features and details

  • Mouse monoclonal [OTI1H2] to SENP2
  • Suitable for: WB, IHC-P, Flow Cyt, ICC/IF
  • Reacts with: Human, African green monkey
  • Isotype: IgG1

You may also be interested in

Product image
Recombinant S. cerevisiae Smt3 protein (His tag) (ab241534)
Product image
Anti-Sumo 3 antibody (ab5317)
Product image
Anti-SAE1 antibody [EPR15398] - BSA and Azide free (ab232630)
Product image
Human SENP5 knockout HeLa cell line (ab265971)

Overview

  • Product name

    Anti-SENP2 antibody [OTI1H2]
    See all SENP2 primary antibodies
  • Description

    Mouse monoclonal [OTI1H2] to SENP2
  • Host species

    Mouse
  • Tested Applications & Species

    Application Species
    Flow Cyt
    Human
    ICC/IF
    African green monkey
    IHC-P
    Human
    WB
    Human
    See all applications and species data
  • Immunogen

    Recombinant fragment corresponding to Human SENP2 aa 139-523. Produced in E.coli (NP_067640).
    Sequence:

    RDQPRRVLPSFGFTLNSEGCNRRPGGRRHSKGNPESSLMWKPQEQAVTEM ISEESGKGLRRPHCTVEEGVQKEEREKYRKLLERLKESGHGNSVCPVTSN YHSSQRSQMDTLKTKGWGEEQNHGVKTTQFVPKQYRLVETRGPLCSLRSE KRCSKGKITDTETMVGIRFENESRRGYQLEPDLSEEVSARLRLGSGSNGL LRRKVSIIETKEKNCSGKERDRRTDDLLELTEDMEKEISNALGHGPQDEI LSSAFKLRITRGDIQTLKNYHWLNDEVINFYMNLLVERNKKQGYPALHVF STFFYPKLKSGGYQAVKRWTKGVNLFEQEIILVPIHRKVHWSLVVIDLRK KCLKYLDSMGQKGHRICEILLQYLQDESKTKRNSD


    Database link: Q9HC62
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • WB: HEK-293T cells transfected with pCMV6-ENTRY SENP2 cDNA. IHC-P: Human prostate carcinoma, prostate, endometrium adenocarcinoma, pancreas carcinoma, pancreas, ovary adenocarcinoma, lung carcinoma and kidney tissues. Flow Cyt: HeLa and Jurkat cells. ICC/IF: COS-7 cells transiently transfected by pCMV6-ENTRY SENP2.
  • General notes

    Clone OTI1H2 (formerly 1H2).

    The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing the problem with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation.

    One factor contributing to the crisis is the use of antibodies that are not suitable. This can lead to misleading results and the use of incorrect data informing project assumptions and direction. To help address this challenge, we have introduced an application and species grid on our primary antibody datasheets to make it easy to simplify identification of the right antibody for your needs.

    Learn more here.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.30
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol, 1% BSA
  • Concentration information loading...
  • Purity

    Affinity purified
  • Purification notes

    Purified from cell culture supernatant by affinity chromatography.
  • Clonality

    Monoclonal
  • Clone number

    OTI1H2
  • Isotype

    IgG1
  • Research areas

    • Cell Biology
    • Proteolysis / Ubiquitin
    • Proteasome / Ubiquitin
    • Sumo
    • Epigenetics and Nuclear Signaling
    • Ubiquitin & Ubiquitin Like Modifiers
    • Ubiquitin like Modifiers

Images

  • Western blot - Anti-SENP2 antibody [OTI1H2] (ab131637)
    Western blot - Anti-SENP2 antibody [OTI1H2] (ab131637)
    All lanes : Anti-SENP2 antibody [OTI1H2] (ab131637) at 1/2000 dilution

    Lane 1 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate transfected with the pCMV6-ENTRY control cDNA
    Lane 2 : HEK-293T cell lysate transfected with pCMV6-ENTRY SENP2 cDNA

    Lysates/proteins at 5 µg per lane.

    Predicted band size: 68 kDa

  • Immunocytochemistry/ Immunofluorescence - Anti-SENP2 antibody [OTI1H2] (ab131637)
    Immunocytochemistry/ Immunofluorescence - Anti-SENP2 antibody [OTI1H2] (ab131637)

    COS-7 (african green monkey kidney fibroblast-like cell line) cells transiently transfected by pCMV6-ENTRY SENP2 stained for SENP2 (green) using ab131637 at 1/100 dilution in ICC/IF.

  • Flow Cytometry - Anti-SENP2 antibody [OTI1H2] (ab131637)
    Flow Cytometry - Anti-SENP2 antibody [OTI1H2] (ab131637)

    Flow cytometric analysis of HeLa (human epithelial cell line from cervix adenocarcinoma) cells labeling SENP2 with ab131637 at 1/100 dilution (Red) compared to a nonspecific negative control antibody (Blue).

  • Flow Cytometry - Anti-SENP2 antibody [OTI1H2] (ab131637)
    Flow Cytometry - Anti-SENP2 antibody [OTI1H2] (ab131637)

    Flow cytometric analysis of Jurkat (human T cell leukemia cell line from peripheral blood) cells labeling SENP2 with ab131637 at 1/100 dilution (Red) compared to a nonspecific negative control antibody (Blue).

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SENP2 antibody [OTI1H2] (ab131637)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SENP2 antibody [OTI1H2] (ab131637)

    Paraffin-embedded human kidney tissue stained for SENP2 using ab131637 at 1/50 dilution in immunohistochemical analysis.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SENP2 antibody [OTI1H2] (ab131637)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SENP2 antibody [OTI1H2] (ab131637)

    Paraffin-embedded human lung carcinoma tissue stained for SENP2 using ab131637 at 1/50 dilution in immunohistochemical analysis.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SENP2 antibody [OTI1H2] (ab131637)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SENP2 antibody [OTI1H2] (ab131637)

    Paraffin-embedded human ovary adenocarcinoma tissue stained for SENP2 using ab131637 at 1/50 dilution in immunohistochemical analysis.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SENP2 antibody [OTI1H2] (ab131637)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SENP2 antibody [OTI1H2] (ab131637)

    Paraffin-embedded human pancreas carcinoma tissue stained for SENP2 using ab131637 at 1/50 dilution in immunohistochemical analysis.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SENP2 antibody [OTI1H2] (ab131637)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SENP2 antibody [OTI1H2] (ab131637)

    Paraffin-embedded human pancreas tissue stained for SENP2 using ab131637 at 1/50 dilution in immunohistochemical analysis.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SENP2 antibody [OTI1H2] (ab131637)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SENP2 antibody [OTI1H2] (ab131637)

    Paraffin-embedded human endometrium adenocarcinoma tissue stained for SENP2 using ab131637 at 1/50 dilution in immunohistochemical analysis.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SENP2 antibody [OTI1H2] (ab131637)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SENP2 antibody [OTI1H2] (ab131637)

    Paraffin-embedded human prostate tissue stained for SENP2 using ab131637 at 1/50 dilution in immunohistochemical analysis.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SENP2 antibody [OTI1H2] (ab131637)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SENP2 antibody [OTI1H2] (ab131637)

    Paraffin-embedded human prostate carcinoma tissue stained for SENP2 using ab131637 at 1/50 dilution in immunohistochemical analysis.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Alternative products to Anti-SENP2 antibody [OTI1H2] (ab131637)

  •  
  • Product image

    Anti-SENP2 antibody (ab58418)

    Applications: ICC/IF, WB

  •  
  • Product image

    Anti-SENP2 antibody (ab96865)

    Applications: ICC/IF, IHC-P, WB

  •  
  • Product image

    Anti-SENP2 antibody [EPR4356(2)] (ab124724)

    Applications: IHC-P, WB

Clear all

Recently viewed products

  •  
  • Product image

    Anti-Bmi1 antibody [BMI1/2823] (ab269678)

  •  
  • Product image

    Anti-Cyclin B1 (phospho S147) antibody (ab131502)

  •  
  • R-(-)-alpha-Methylhistamine dihydrobromide, H<sub>3</sub> receptor agonist (ab120774)

Get resources and offers direct to your inbox Sign up
© 2021 Astana Biomed Group LLP. All rights reserved.