Anti-SCP3 antibody [6F9C5] (ab181746)
Key features and details
- Mouse monoclonal [6F9C5] to SCP3
- Suitable for: IHC-P, WB, ICC/IF, Flow Cyt
- Reacts with: Human, Recombinant fragment
- Isotype: IgG1
Overview
-
Product name
Anti-SCP3 antibody [6F9C5]
See all SCP3 primary antibodies -
Description
Mouse monoclonal [6F9C5] to SCP3 -
Host species
Mouse -
Tested Applications & Species
See all applications and species dataApplication Species Flow Cyt HumanICC/IF HumanIHC-P HumanWB HumanRecombinant fragment -
Immunogen
Recombinant fragment corresponding to Human SCP3 aa 27-128. Expressed in E. Coli.
Sequence:FETEDKKDLSGSEEDVIEGKTAVIEKRRKKRSSAGVVEDMGGEVQNMLEG VGVDINKALLAKRKRLEMYTKASLKTSNQKIEHVWKTQQDQRQKLNQEYS QQ
Database link: Q8IZU3 -
Positive control
- SCP3 recombinant protein; SCP3 (aa 27-128)-hIgGFc transfected HEK293 cell lysate; HepG2 cells; Jurkat cells; Human cervical cancer and Human kidney tissues.
-
General notes
This product was changed from ascites to supernatant. Lot no’s high than GR160891-17 are from Tissue Culture Supernatant
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing the problem with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation.
One factor contributing to the crisis is the use of antibodies that are not suitable. This can lead to misleading results and the use of incorrect data informing project assumptions and direction. To help address this challenge, we have introduced an application and species grid on our primary antibody datasheets to make it easy to simplify identification of the right antibody for your needs.
Learn more here.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.05% Sodium azide
Constituent: 99% PBS
0.5% protein stabilizer -
Concentration information loading... -
Purity
Protein G purified -
Purification notes
Purified from tissue culture supernatant. -
Clonality
Monoclonal -
Clone number
6F9C5 -
Isotype
IgG1 -
Research areas
Images
-
Immunofluorescent analysis of HepG2 cells labeling SPC3 with ab181746 at 1/200 (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
-
Anti-SCP3 antibody [6F9C5] (ab181746) at 1/500 dilution + SCP3 recombinant protein
Predicted band size: 28 kDa
-
All lanes : Anti-SCP3 antibody [6F9C5] (ab181746) at 1/500 dilution
Lane 1 : non-transfected HEK293 cell lysate
Lane 2 : SCP3 (aa 27-128)-hIgGFc transfected HEK293 cell lysate
Predicted band size: 28 kDa
-
Flow Cytometrical analysis of Jurkat cells labeling SCP3 with ab181746 at 1/200 (green) compared to a negative control antibody (red).
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SCP3 antibody [6F9C5] (ab181746)Immunohistochemical analysis of paraffin embedded Human kidney tissue labeling SCP3 with ab181746 at 1/200.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SCP3 antibody [6F9C5] (ab181746)Immunohistochemical analysis of paraffin embedded Human cervical cancer tissue labeling SCP3 with ab181746 at 1/200.

