Anti-RRP41 antibody (ab137250)
Key features and details
- Rabbit polyclonal to RRP41
- Suitable for: WB, IP
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-RRP41 antibody -
Description
Rabbit polyclonal to RRP41 -
Host species
Rabbit -
Tested Applications & Species
See all applications and species dataApplication Species IP HumanWB Human
-
Immunogen
Synthetic peptide within Human RRP41 aa 1-50. The exact sequence is proprietary.
Sequence:MAGLELLSDQGYRVDGRRAGELRKIQARMGVFAQADGSAYIEQGNTKALA
Database link: NP_061910.1 -
Positive control
- HeLa, 293T and Jurkat whole cell lysate (ab7899)
-
General notes
Protein previously labeled as EXOSC4.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. -
Storage buffer
pH: 7
Preservative: 0.09% Sodium azide
Constituent: 99% Tris citrate/phosphate
pH 7 to 8 -
Concentration information loading... -
Purity
Immunogen affinity purified -
Purification notes
ab137250 was affinity purified using an epitope specific to RRP41 immobilized on solid support. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Images
-
Western blot - Anti-RRP41 antibody (ab137250)All lanes : Anti-RRP41 antibody (ab137250) at 0.4 µg/ml
Lane 1 : HeLa whole cell lysate at 50 µg
Lane 2 : HeLa whole cell lysate at 15 µg
Lane 3 : 293T whole cell lysate at 50 µg
Lane 4 : Jurkat whole cell lysate at 50 µg
Developed using the ECL technique.
Predicted band size: 26 kDa
Exposure time: 3 minutes
-
Immunoprecipitation - Anti-RRP41 antibody (ab137250)Immunoprecipitation with ab137250 at 6µg/mg lysate. 1 mg of HeLa whole cell lysate used for IP (20% of IP loaded). Western blot labelling RRP41 with ab137250 at 1 µg/ml. Detected by chemiluminescence with exposure time of 30 seconds.