Anti-RICS antibody (ab150847)
Key features and details
- Rabbit polyclonal to RICS
- Suitable for: ICC/IF, IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-RICS antibody -
Description
Rabbit polyclonal to RICS -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IF, IHC-Pmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat
-
Immunogen
Recombinant fragment corresponding to Human RICS aa 1998-2087.
Sequence:ERDPSVLYQYQPHGKRQSSVTVVSQYDNLEDYHSLPQHQRGVFGGGGMGT YVPPGFPHPQSRTYATALGQGAFLPAELSLQHPETQIHAE
-
Positive control
- IHC-P: Human cerebellum, small intestine and skin tissue; ICC: HaCaT whole cells.
-
General notes
The antibody solution should be gently mixed before use.Previously labelled as ARHGAP32.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol (glycerin, glycerine), 59% PBS -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-RICS antibody (ab150847)
Immunohistochemical analysis of human cerebellum tissue labeling RICS in Purkinje cells with ab1590847 at a 1/50 dilution.
Performed heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
-
Immunocytochemistry/ Immunofluorescence - Anti-RICS antibody (ab150847)Immunocytochemical analysis of HaCaT (Human keratinocyte cell line) whole cells labeling RICS in the nucleoplasm, nucleoli fibrillar center and Golgi apparatus with ab1590847 at 2 µg/ml.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-RICS antibody (ab150847)Immunohistochemical analysis of human small intestine tissue labeling RICS in the luminal membrane of glandular cells with ab1590847 at a 1/50 dilution.
Performed heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-RICS antibody (ab150847)Immunohistochemical analysis of human skin tissue labeling RICS in the cytoplasm of squamous epithelial cells with ab1590847 at a 1/50 dilution.
Performed heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-RICS antibody (ab150847)Immunohistochemical analysis of human liver tissue labeling RICS with ab1590847 at a 1/50 dilution. No positivity as expected.
Performed heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.