Anti-RhoA + C antibody [1B34A10] (ab175359)
Key features and details
- Mouse monoclonal [1B34A10] to RhoA + C
- Suitable for: IP, ICC/IF, WB
- Reacts with: Mouse, Human
- Isotype: IgG
Overview
-
Product name
Anti-RhoA + C antibody [1B34A10] -
Description
Mouse monoclonal [1B34A10] to RhoA + C -
Host species
Mouse -
Tested applications
Suitable for: IP, ICC/IF, WBmore details -
Species reactivity
Reacts with: Mouse, Human -
Immunogen
Recombinant full length protein corresponding to Human RhoA + C aa 1-193.
Sequence:MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDG KQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWT PEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANR IGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKKSGCLVL
Database link: P61586 -
Positive control
- HeLa, A431, HEK293T, NIH 3T3, U2 OS and K562 whole cell lysates; RhoA and RhoC recombinant proteins; HeLa cells.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.05% Sodium azide
Constituents: 0.1% BSA, 30% Glycerol (glycerin, glycerine), 69% PBS -
Concentration information loading... -
Purity
Protein A purified -
Clonality
Monoclonal -
Clone number
1B34A10 -
Isotype
IgG -
Research areas
Images
-
All lanes : Anti-RhoA + C antibody [1B34A10] (ab175359) at 1/1000 dilution
Lane 1 : HeLa whole cell lysate at 25 µg
Lane 2 : A431 whole cell lysate at 25 µg
Lane 3 : HEK293T whole cell lysate at 25 µg
Lane 4 : U2 OS whole cell lysate at 25 µg
Lane 5 : NIH 3T3 whole cell lysate at 25 µg
Lane 6 : K562 whole cell lysate at 25 µg
Lane 7 : RhoA purified protein at 0.5 µg
Lane 8 : RhoB purified protein at 0.5 µg
Lane 9 : RhoC purified protein with proprietary tag at 0.5 µg
Secondary
All lanes : goat anti-mouse IgG-HRP at 1/15000 dilution
Developed using the ECL technique.
Predicted band size: 22 kDa
-
Immunofluorescent analysis of HeLa cells (formalin-fixed, 0.1% Triton X-100 permeabilized) labeling RhoA + C with ab175359 at 1/100 dilution followed with DyLight 488 goat anti-mouse IgG secondary antibody at 1/400 dilution. Nuclei (blue) were stained with Hoechst 33342 dye.
-
Immunoprecipitation analysis of RhoA + C was performed on HeLa cells. Antigen-antibody complexes were formed by incubating 500μg of whole cell lysate with 2μg ab175359 (lane 2).
HeLa cell lysate was run as a control (lane 1).
For WB detection, ab175359 was used at 1/1000 dilution.

