Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category
Signal Transduction Cytoskeleton / ECM Cytoskeleton Microfilaments Actin etc Actin Binding Proteins

Anti-RhoA + C antibody [1B34A10] (ab175359)

Anti-RhoA + C antibody [1B34A10] (ab175359)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)

Key features and details

  • Mouse monoclonal [1B34A10] to RhoA + C
  • Suitable for: IP, ICC/IF, WB
  • Reacts with: Mouse, Human
  • Isotype: IgG

You may also be interested in

Product image
Anti-Activin Receptor Type IA antibody [MM0052-9J17] (ab78414)
Recombinant Human LMCD1 protein (ab185398)
Product image
Anti-CAP2 antibody [EPR6378] (ab133558)
Recombinant Human Vinculin protein (ab151336)

Overview

  • Product name

    Anti-RhoA + C antibody [1B34A10]
  • Description

    Mouse monoclonal [1B34A10] to RhoA + C
  • Host species

    Mouse
  • Tested applications

    Suitable for: IP, ICC/IF, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant full length protein corresponding to Human RhoA + C aa 1-193.
    Sequence:

    MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDG KQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWT PEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANR IGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKKSGCLVL


    Database link: P61586
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • HeLa, A431, HEK293T, NIH 3T3, U2 OS and K562 whole cell lysates; RhoA and RhoC recombinant proteins; HeLa cells.
  • General notes

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.05% Sodium azide
    Constituents: 0.1% BSA, 30% Glycerol (glycerin, glycerine), 69% PBS
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Monoclonal
  • Clone number

    1B34A10
  • Isotype

    IgG
  • Research areas

    • Signal Transduction
    • Cytoskeleton / ECM
    • Cytoskeleton
    • Microfilaments
    • Actin etc
    • Actin Binding Proteins
    • Signal Transduction
    • Signaling Pathway
    • G Protein Signaling
    • Heterotrimeric G Proteins
    • G Proteins
    • Signal Transduction
    • Signaling Pathway
    • G Protein Signaling
    • GPCR

Images

  • Western blot - Anti-RhoA + C antibody [1B34A10] (ab175359)
    Western blot - Anti-RhoA + C antibody [1B34A10] (ab175359)
    All lanes : Anti-RhoA + C antibody [1B34A10] (ab175359) at 1/1000 dilution

    Lane 1 : HeLa whole cell lysate at 25 µg
    Lane 2 : A431 whole cell lysate at 25 µg
    Lane 3 : HEK293T whole cell lysate at 25 µg
    Lane 4 : U2 OS whole cell lysate at 25 µg
    Lane 5 : NIH 3T3 whole cell lysate at 25 µg
    Lane 6 : K562 whole cell lysate at 25 µg
    Lane 7 : RhoA purified protein at 0.5 µg
    Lane 8 : RhoB purified protein at 0.5 µg
    Lane 9 : RhoC purified protein with proprietary tag at 0.5 µg

    Secondary
    All lanes : goat anti-mouse IgG-HRP at 1/15000 dilution

    Developed using the ECL technique.

    Predicted band size: 22 kDa

  • Immunocytochemistry/ Immunofluorescence - Anti-RhoA + C antibody [1B34A10] (ab175359)
    Immunocytochemistry/ Immunofluorescence - Anti-RhoA + C antibody [1B34A10] (ab175359)

    Immunofluorescent analysis of HeLa cells (formalin-fixed, 0.1% Triton X-100 permeabilized) labeling RhoA + C with ab175359 at 1/100 dilution followed with DyLight 488 goat anti-mouse IgG secondary antibody at 1/400 dilution. Nuclei (blue) were stained with Hoechst 33342 dye.

  • Immunoprecipitation - Anti-RhoA + C antibody [1B34A10] (ab175359)
    Immunoprecipitation - Anti-RhoA + C antibody [1B34A10] (ab175359)

    Immunoprecipitation analysis of RhoA + C was performed on HeLa cells. Antigen-antibody complexes were formed by incubating 500μg of whole cell lysate with 2μg ab175359 (lane 2).

    HeLa cell lysate was run as a control (lane 1).

    For WB detection, ab175359 was used at 1/1000 dilution.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Clear all

Recently viewed products

  •  
  • Product image

    Anti-M6PR (cation independent) antibody [MEM-238] (ab8093)

  •  
  • Product image

    Anti-SCGN/Secretagogin antibody (ab111871)

  •  
  • Product image

    Recombinant human Activin Receptor Type IA (mutated R206H) protein (ab167922)

  •  
  • Recombinant Human IL-33 protein (Fc Chimera) (ab216186)

Get resources and offers direct to your inbox Sign up
© 2021 Astana Biomed Group LLP. All rights reserved.