Anti-Rex1 antibody [5E11E7] (ab175431)
Key features and details
- Mouse monoclonal [5E11E7] to Rex1
- Suitable for: IHC-P, WB, Flow Cyt
- Reacts with: Human, Recombinant fragment
- Isotype: IgG1
Overview
-
Product name
Anti-Rex1 antibody [5E11E7]
See all Rex1 primary antibodies -
Description
Mouse monoclonal [5E11E7] to Rex1 -
Host species
Mouse -
Tested applications
Suitable for: IHC-P, WB, Flow Cytmore details -
Species reactivity
Reacts with: Human, Recombinant fragment -
Immunogen
Recombinant fragment corresponding to Human Rex1 aa 249-310. (Expressed in E.coli).
Sequence:FEGCGKRFSLDFNLRTHVRIHTGEKRFVCPFQGCNRRFIQSNNLKAHILT HANTNKNEQEGK
Database link: Q96MM3 -
Positive control
- Rex 1 recombinant protein; Rex1 (aa249-310) - hIgGFc transfected HEK293 cell lysate; Jurkat, Raji, HEK293 and PC-3 cell lysates; HEK293 cells; Human rectum cancer tissue; Human esophagus cancer tissue.
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.05% Sodium azide
Constituent: 99% PBS
Contains 0.5% protein stabiliser. -
Concentration information loading... -
Purity
Protein G purified -
Purification notes
Purified from tissue culture supernatant. -
Clonality
Monoclonal -
Clone number
5E11E7 -
Isotype
IgG1 -
Research areas
Images
-
All lanes : Anti-Rex1 antibody [5E11E7] (ab175431) at 1/500 dilution
Lane 1 : HEK293 cell lysate
Lane 2 : Rex1 (aa 249-310) - hIgGFc transfected HEK293 cell lysate
Predicted band size: 35 kDa
-
Anti-Rex1 antibody [5E11E7] (ab175431) at 1/500 dilution + Rex1 recombinant protein
Predicted band size: 35 kDaExpected MWt is 32.7 kDa.
-
All lanes : Anti-Rex1 antibody [5E11E7] (ab175431) at 1/500 dilution
Lane 1 : Jurkat cell lysate
Lane 2 : HEK293 cell lysate
Lane 3 : Raji cell lysate
Lane 4 : PC-3 cell lysate
Predicted band size: 35 kDa
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Rex1 antibody [5E11E7] (ab175431)Immunohistochemical analysis of paraffin-embedded Human esophagus cancer tissue labeling Rex1 with ab175431 at 1/200 dilution with DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Rex1 antibody [5E11E7] (ab175431)Immunohistochemical analysis of paraffin-embedded Human rectum cancer tissue labeling Rex1 with ab175431 at 1/200 dilution with DAB staining.
-
Flow cytometric analysis of HEK293 cells labeling Rex1 with ab175431 at 1/200 dilution (green) compared to a negative control (red).

