Anti-RAB27A antibody (ab55667)
Key features and details
- Mouse monoclonal to RAB27A
- Suitable for: WB, IHC-P
- Knockout validated
- Reacts with: Human
- Isotype: IgG1
Overview
-
Product name
Anti-RAB27A antibody
See all RAB27A primary antibodies -
Description
Mouse monoclonal to RAB27A -
Host species
Mouse -
Tested Applications & Species
See all applications and species dataApplication Species IHC-P HumanWB Human -
Immunogen
Recombinant fragment corresponding to Human RAB27A aa 122-221.
Sequence:YCENPDIVLCGNKSDLEDQRVVKEEEAIALAEKYGIPYFETSAANGTNIS QAIEMLLDLIMKRMERCVDKSWIPEGVVRSNGHASTDQLSEEKEKGACGC
Database link: P51159 -
Positive control
- WB: HAP1, Jurkat, MCF7 whole cell lysate; HL-60 cells; 293 cells, IHC-P: Human lymphoma. ICC/IF: Cow Retinal Pigment Epithelium (RPE) cells
-
General notes
This product was changed from ascites to tissue culture supernatant on 13th Feb 2019. Please note that the dilutions may need to be adjusted accordingly. If you have any questions, please do not hesitate to contact our scientific support team.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. -
Storage buffer
pH: 7.4 -
Concentration information loading... -
Purity
Tissue culture supernatant -
Clonality
Monoclonal -
Isotype
IgG1 -
Light chain type
kappa -
Research areas
Images
-
Lane 1: Wild type HAP1 whole cell lysate (20 µg)
Lane 2: RAB27A knockout HAP1 whole cell lysate (20 µg)
Lane 3: Jurkat whole cell lysate (20 µg)
Lane 4: MCF7 whole cell lysate (20 µg)Lanes 1 - 4: Merged signal (red and green). Green - ab55667 observed at 27 kDa. Red - loading control, ab181602, observed at 37 kDa.
ab55667 was shown to specifically react with RAB27A when RAB27A knockout samples were used. Wild-type and RAB27A knockout samples were subjected to SDS-PAGE. Ab55667 and ab181602 (Rabbit anti GAPDH loading control) were incubated overnight at 4°C at 2.5 ug/ml and 1/10000 dilution respectively. Blots were developed with IRDye® 800CW Goat anti-Mouse IgG (H + L) and IRDye® 680 Goat anti-Rabbit IgG (H + L) secondary antibodies at 1/10000 dilution for 1 hour at room temperature before imaging.
This image was generated using the ascites version of the product.
-
Anti-RAB27A antibody (ab55667) + HL-60 cell lysate
Predicted band size: 25 kDaThis image was generated using the ascites version of the product.
-
All lanes : Anti-RAB27A antibody (ab55667)
Lane 1 : RAB27A over-expressed 293 cell line, cotransfected with RAB27A Validated Chimera RNAi
Lane 2 : Non-transfected control
Predicted band size: 25 kDaGAPDH (36.1 kDa) used as specificity and loading control.
This image was generated using the ascites version of the product.
-
All lanes : Anti-RAB27A antibody (ab55667)
Lane 1 : RAB27A transfected lysate(24.9 KDa)
Lane 2 : Non-transfected lysate
Predicted band size: 25 kDaThis image was generated using the ascites version of the product.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-RAB27A antibody (ab55667)RAB27A antibody (ab55667) used in immunohistochemistry at 3ug/ml on formalin fixed and paraffin embedded human lymphoma. Heat induced antigen retrieval with Citrate buffer pH 6 has been performed prior to immunostaining.
This image was generated using the ascites version of the product.
-
Western blot - Anti-RAB27A antibody (ab55667) This image is courtesy of an Abreview submitted by Dr Vladimir MilenkovicAll lanes : Anti-RAB27A antibody (ab55667) at 1/200 dilution
Lane 1 : whole cell lysate of HEK 293 transfected with empty pCDNA3 vector
Lane 2 : whole cell lysate of HEK 293 cells expressing Rab27a-GFP
Lysates/proteins at 20 µg per lane.
Secondary
All lanes : HRP conjugated goat anti-mouse
Developed using the ECL technique.
Predicted band size: 25 kDa
Observed band size: 52 kDa why is the actual band size different from the predicted?
Exposure time: 30 minutesRab27a (25kDa)+GFP(27kDa)=52kDa
The blot was blocked with 5% milk for 30 minutes at 25°C and incubated with the primary antibody for 12 hours at 4°C.
This image was generated using the ascites version of the product.

