Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category
Signal Transduction Signaling Pathway G Protein Signaling Small G Proteins Ras Family

Anti-RAB27A antibody (ab55667)

Price and availability

381 945 ₸

Availability

Order now and get it on Tuesday March 02, 2021

Anti-RAB27A antibody (ab55667)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)

Key features and details

  • Mouse monoclonal to RAB27A
  • Suitable for: WB, IHC-P
  • Knockout validated
  • Reacts with: Human
  • Isotype: IgG1

You may also be interested in

Product image
Anti-RASGRF2 antibody (ab121577)
Product image
Anti-RAB8A antibody [MJF-R22-79-3] (ab241061)
Product image
Anti-TC21 antibody (ab96307)
Product image
Anti-ARF1+ARF3 antibody [EP442Y] - BSA and Azide free (ab247266)

Overview

  • Product name

    Anti-RAB27A antibody
    See all RAB27A primary antibodies
  • Description

    Mouse monoclonal to RAB27A
  • Host species

    Mouse
  • Tested Applications & Species

    Application Species
    IHC-P
    Human
    WB
    Human
    See all applications and species data
  • Immunogen

    Recombinant fragment corresponding to Human RAB27A aa 122-221.
    Sequence:

    YCENPDIVLCGNKSDLEDQRVVKEEEAIALAEKYGIPYFETSAANGTNIS QAIEMLLDLIMKRMERCVDKSWIPEGVVRSNGHASTDQLSEEKEKGACGC


    Database link: P51159
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • WB: HAP1, Jurkat, MCF7 whole cell lysate; HL-60 cells; 293 cells, IHC-P: Human lymphoma. ICC/IF: Cow Retinal Pigment Epithelium (RPE) cells
  • General notes

    This product was changed from ascites to tissue culture supernatant on 13th Feb 2019. Please note that the dilutions may need to be adjusted accordingly. If you have any questions, please do not hesitate to contact our scientific support team.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer

    pH: 7.4
  • Concentration information loading...
  • Purity

    Tissue culture supernatant
  • Clonality

    Monoclonal
  • Isotype

    IgG1
  • Light chain type

    kappa
  • Research areas

    • Signal Transduction
    • Signaling Pathway
    • G Protein Signaling
    • Small G Proteins
    • Ras Family
    • Signal Transduction
    • Protein Trafficking
    • Vesicle Transport
    • Regulation

Images

  • Western blot - Anti-RAB27A antibody (ab55667)
    Western blot - Anti-RAB27A antibody (ab55667)

    Lane 1: Wild type HAP1 whole cell lysate (20 µg)
    Lane 2: RAB27A knockout HAP1 whole cell lysate (20 µg)
    Lane 3: Jurkat whole cell lysate (20 µg)
    Lane 4: MCF7 whole cell lysate (20 µg)

    Lanes 1 - 4: Merged signal (red and green). Green - ab55667 observed at 27 kDa. Red - loading control, ab181602, observed at 37 kDa.

    ab55667 was shown to specifically react with RAB27A when RAB27A knockout samples were used. Wild-type and RAB27A knockout samples were subjected to SDS-PAGE. Ab55667 and ab181602 (Rabbit anti GAPDH loading control) were incubated overnight at 4°C at 2.5 ug/ml and 1/10000 dilution respectively. Blots were developed with IRDye® 800CW Goat anti-Mouse IgG (H + L) and IRDye® 680 Goat anti-Rabbit IgG (H + L) secondary antibodies at 1/10000 dilution for 1 hour at room temperature before imaging.

    This image was generated using the ascites version of the product.

  • Western blot - Anti-RAB27A antibody (ab55667)
    Western blot - Anti-RAB27A antibody (ab55667)
    Anti-RAB27A antibody (ab55667) + HL-60 cell lysate

    Predicted band size: 25 kDa



    This image was generated using the ascites version of the product.

  • Western blot - Anti-RAB27A antibody (ab55667)
    Western blot - Anti-RAB27A antibody (ab55667)
    All lanes : Anti-RAB27A antibody (ab55667)

    Lane 1 : RAB27A over-expressed 293 cell line, cotransfected with RAB27A Validated Chimera RNAi
    Lane 2 : Non-transfected control

    Predicted band size: 25 kDa



    GAPDH (36.1 kDa) used as specificity and loading control.

    This image was generated using the ascites version of the product.

  • Western blot - Anti-RAB27A antibody (ab55667)
    Western blot - Anti-RAB27A antibody (ab55667)
    All lanes : Anti-RAB27A antibody (ab55667)

    Lane 1 : RAB27A transfected lysate(24.9 KDa)
    Lane 2 : Non-transfected lysate

    Predicted band size: 25 kDa



    This image was generated using the ascites version of the product.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-RAB27A antibody (ab55667)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-RAB27A antibody (ab55667)

    RAB27A antibody (ab55667) used in immunohistochemistry at 3ug/ml on formalin fixed and paraffin embedded human lymphoma. Heat induced antigen retrieval with Citrate buffer pH 6 has been performed prior to immunostaining.

    This image was generated using the ascites version of the product.

  • Western blot - Anti-RAB27A antibody (ab55667)
    Western blot - Anti-RAB27A antibody (ab55667) This image is courtesy of an Abreview submitted by Dr Vladimir Milenkovic
    All lanes : Anti-RAB27A antibody (ab55667) at 1/200 dilution

    Lane 1 : whole cell lysate of HEK 293 transfected with empty pCDNA3 vector
    Lane 2 : whole cell lysate of HEK 293 cells expressing Rab27a-GFP

    Lysates/proteins at 20 µg per lane.

    Secondary
    All lanes : HRP conjugated goat anti-mouse

    Developed using the ECL technique.

    Predicted band size: 25 kDa
    Observed band size: 52 kDa
    why is the actual band size different from the predicted?


    Exposure time: 30 minutes


    Rab27a (25kDa)+GFP(27kDa)=52kDa

    The blot was blocked with 5% milk for 30 minutes at 25°C and incubated with the primary antibody for 12 hours at 4°C.

    This image was generated using the ascites version of the product.

    See Abreview

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Alternative products to Anti-RAB27A antibody (ab55667)

  •  
  • Product image

    Anti-RAB27A antibody (ab223044)

    Applications: ICC/IF, IHC-P

  •  
  • Product image

    Anti-RAB27A antibody (ab214930)

    Applications: WB

Clear all

Recently viewed products

  •  
  • Product image

    Anti-NDUFB8 antibody (ab134367)

  •  
  • Product image

    Anti-p23 antibody (ab227106)

  •  
  • Product image

    Anti-TTDN1 antibody (ab221555)

  •  
  • Product image

    Anti-SCP3 antibody (ab154255)

  •  
  • Product image

    Recombinant human Tnk1 protein (Active) (ab271770)

Get resources and offers direct to your inbox Sign up
© 2021 Astana Biomed Group LLP. All rights reserved.