Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category
Cell Biology Proteolysis / Ubiquitin Proteasome / Ubiquitin Proteasome

Anti-PSMA3 antibody (ab180784)

Anti-PSMA3 antibody (ab180784)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)

Key features and details

  • Rabbit polyclonal to PSMA3
  • Suitable for: WB, ICC/IF, IP
  • Reacts with: Mouse, Rat, Human
  • Isotype: IgG

You may also be interested in

Product image
Anti-SFRP1 antibody [EPR23092-253] (ab267466)
Product image
Recombinant Human PSME2 protein (ab117228)
Product image
Anti-PSMG1 antibody [EPR10223] - BSA and Azide free (ab249415)
Anti-RPN10/SUN1 antibody (ab98843)

Overview

  • Product name

    Anti-PSMA3 antibody
    See all PSMA3 primary antibodies
  • Description

    Rabbit polyclonal to PSMA3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IF, IPmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant full length protein corresponding to Human PSMA3 aa 1-255.
    Sequence:

    MSSIGTGYDLSASTFSPDGRVFQVEYAMKAVENSSTAIGIRCKDGVVFGV EKLVLSKLYEEGSNKRLFNVDRHVGMAVAGLLADARSLADIAREEASNFR SNFGYNIPLKHLADRVAMYVHAYTLYSAVRPFGCSFMLGSYSVNDGAQLY MIDPSGVSYGYWGCAIGKARQAAKTEIEKLQMKEMTCRDIVKEVAKIIYI VHDEVKDKAFELELSWVGELTNGRHEIVPKDIREEAEKYAKESLKEEDES DDDNM


    Database link: P25788
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • JAR, A549 and PC12 cell extracts.
  • General notes

     This product was previously labelled as Proteasome 20S alpha 3

     

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.30
    Preservative: 0.02% Sodium azide
    Constituents: 49% PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

    • Cell Biology
    • Proteolysis / Ubiquitin
    • Proteasome / Ubiquitin
    • Proteasome

Images

  • Western blot - Anti-PSMA3 antibody (ab180784)
    Western blot - Anti-PSMA3 antibody (ab180784)
    All lanes : Anti-PSMA3 antibody (ab180784) at 1/1000 dilution

    Lane 1 : MCF7 cell lysate with 3% nonfat dry milk in TBST
    Lane 2 : DU145 cell lysate with 3% nonfat dry milk in TBST
    Lane 3 : HL-60 cell lysate with 3% nonfat dry milk in TBST
    Lane 4 : PC-3 cell lysate with 3% nonfat dry milk in TBST
    Lane 5 : Mouse liver lysate with 3% nonfat dry milk in TBST
    Lane 6 : Mouse spleen lysate with 3% nonfat dry milk in TBST

    Lysates/proteins at 25 µg per lane.

    Secondary
    All lanes : HRP Goat Anti-Rabbit IgG (H+L) at 1/10000 dilution

    Predicted band size: 28 kDa

  • Immunoprecipitation - Anti-PSMA3 antibody (ab180784)
    Immunoprecipitation - Anti-PSMA3 antibody (ab180784)

    Immunoprecipitation analysis of 200 μg extracts of HL-60 cells, using 3 μg of ab180784. Western blot was performed from the immunoprecipitate using ab180784 at a dilition of 1:1000.

  • Western blot - Anti-PSMA3 antibody (ab180784)
    Western blot - Anti-PSMA3 antibody (ab180784)
    All lanes : Anti-PSMA3 antibody (ab180784) at 1/500 dilution

    Lane 1 : JAR cell extracts
    Lane 2 : A549 cell extracts
    Lane 3 : PC12 cell extracts

    Predicted band size: 28 kDa

  • Immunocytochemistry/ Immunofluorescence - Anti-PSMA3 antibody (ab180784)
    Immunocytochemistry/ Immunofluorescence - Anti-PSMA3 antibody (ab180784)
    Immunocytochemistry/Immunofluorescence analysis of MCF7 cells using ab180784. Blue DAPI for nuclear staining.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Alternative products to Anti-PSMA3 antibody (ab180784)

  •  
  • Product image

    Anti-PSMA3 antibody (ab96746)

    Applications: IHC-P, WB

  •  
  • Product image

    Anti-PSMA3 antibody (ab264307)

    Applications: WB

  •  
  • Product image

    Anti-PSMA3 antibody [EPR5455] (ab109532)

    Applications: ICC/IF, IHC-P, WB

  •  
  • Product image

    Anti-PSMA3 (phospho S250) antibody (ab79184)

    Applications: WB

Clear all

Recently viewed products

  •  
  • Product image

    Anti-USP39 antibody [EPR8684] (ab131332)

  •  
  • Product image

    Anti-Human IgG antibody [IG266] (ab200699)

  •  
  • Product image

    Anti-ZBT10 antibody (ab80879)

  •  
  • Product image

    Anti-RAG2 antibody (ab72962)

Get resources and offers direct to your inbox Sign up
© 2021 Astana Biomed Group LLP. All rights reserved.