Anti-PSMA3 antibody (ab180784)
Key features and details
- Rabbit polyclonal to PSMA3
- Suitable for: WB, ICC/IF, IP
- Reacts with: Mouse, Rat, Human
- Isotype: IgG
Overview
-
Product name
Anti-PSMA3 antibody
See all PSMA3 primary antibodies -
Description
Rabbit polyclonal to PSMA3 -
Host species
Rabbit -
Tested applications
Suitable for: WB, ICC/IF, IPmore details -
Species reactivity
Reacts with: Mouse, Rat, Human -
Immunogen
Recombinant full length protein corresponding to Human PSMA3 aa 1-255.
Sequence:MSSIGTGYDLSASTFSPDGRVFQVEYAMKAVENSSTAIGIRCKDGVVFGV EKLVLSKLYEEGSNKRLFNVDRHVGMAVAGLLADARSLADIAREEASNFR SNFGYNIPLKHLADRVAMYVHAYTLYSAVRPFGCSFMLGSYSVNDGAQLY MIDPSGVSYGYWGCAIGKARQAAKTEIEKLQMKEMTCRDIVKEVAKIIYI VHDEVKDKAFELELSWVGELTNGRHEIVPKDIREEAEKYAKESLKEEDES DDDNM
Database link: P25788 -
Positive control
- JAR, A549 and PC12 cell extracts.
-
General notes
This product was previously labelled as Proteasome 20S alpha 3
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.30
Preservative: 0.02% Sodium azide
Constituents: 49% PBS, 50% Glycerol -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Images
-
All lanes : Anti-PSMA3 antibody (ab180784) at 1/1000 dilution
Lane 1 : MCF7 cell lysate with 3% nonfat dry milk in TBST
Lane 2 : DU145 cell lysate with 3% nonfat dry milk in TBST
Lane 3 : HL-60 cell lysate with 3% nonfat dry milk in TBST
Lane 4 : PC-3 cell lysate with 3% nonfat dry milk in TBST
Lane 5 : Mouse liver lysate with 3% nonfat dry milk in TBST
Lane 6 : Mouse spleen lysate with 3% nonfat dry milk in TBST
Lysates/proteins at 25 µg per lane.
Secondary
All lanes : HRP Goat Anti-Rabbit IgG (H+L) at 1/10000 dilution
Predicted band size: 28 kDa
-
Immunoprecipitation analysis of 200 μg extracts of HL-60 cells, using 3 μg of ab180784. Western blot was performed from the immunoprecipitate using ab180784 at a dilition of 1:1000.
-
All lanes : Anti-PSMA3 antibody (ab180784) at 1/500 dilution
Lane 1 : JAR cell extracts
Lane 2 : A549 cell extracts
Lane 3 : PC12 cell extracts
Predicted band size: 28 kDa
-
Immunocytochemistry/Immunofluorescence analysis of MCF7 cells using ab180784. Blue DAPI for nuclear staining.