Anti-Proteasome 20S C2/HC2 antibody (ab140499)
Key features and details
- Rabbit polyclonal to Proteasome 20S C2/HC2
- Suitable for: WB, IP
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-Proteasome 20S C2/HC2 antibody
See all Proteasome 20S C2/HC2 primary antibodies -
Description
Rabbit polyclonal to Proteasome 20S C2/HC2 -
Host species
Rabbit -
Tested applications
Suitable for: WB, IPmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Rabbit, Horse, Guinea pig, Cow, Dog, Pig, Chimpanzee, Ferret, Rhesus monkey, Gorilla, Orangutan
-
Immunogen
Synthetic peptide corresponding to Human Proteasome 20S C2/HC2 aa 213-263.
Sequence:GIVGKDLEFTIYDDDDVSPFLEGLEERPQRKAQPAQPADEPAEKADEPME H
Database link: P25786 -
Positive control
- 293T, HeLa, Jurkat whole cell lysates.
-
General notes
This product was previously labelled as Proteasome 20S C2
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. -
Storage buffer
pH: 7
Preservative: 0.09% Sodium azide
Constituent: 99% Tris citrate/phosphate
pH: 7 to 8 -
Concentration information loading... -
Purity
Immunogen affinity purified -
Purification notes
ab140499 was affinity purified using an epitope specific to Proteasome 20S C2/HC2 immobilized on a solid support. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Images
-
All lanes : Anti-Proteasome 20S C2/HC2 antibody (ab140499) at 0.1 µg/ml
Lane 1 : 293T whole cell lysate at 50 µg
Lane 2 : 293T whole cell lysate at 15 µg
Lane 3 : HeLa whole cell lysate at 50 µg
Lane 4 : Jurkat whole cell lysate at 50 µg
Developed using the ECL technique.
Predicted band size: 30 kDa
Exposure time: 30 seconds
-
ab140499 at 1 µg/ml detecting Proteasome 20S C2/HC2 in 293T whole cell lysate by WB following IP.
Lane 1: ab140499 at 6µg/mg of lysate.
Lane 2: Control IgG.
In each case, 1 mg of lysate was used for IP and 20% of the IP was loaded. Detection: Chemiluminescence with an exposure time of 30 seconds.

