Anti-PPAP2A antibody [OTI1H4] (ab170151)
Key features and details
- Mouse monoclonal [OTI1H4] to PPAP2A
- Suitable for: WB, IHC-P
- Reacts with: Human
- Isotype: IgG1
Overview
-
Product name
Anti-PPAP2A antibody [OTI1H4]
See all PPAP2A primary antibodies -
Description
Mouse monoclonal [OTI1H4] to PPAP2A -
Host species
Mouse -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Guinea pig -
Immunogen
Recombinant full length protein corresponding to Human PPAP2A aa 1-284.
Sequence:MFDKTRLPYVALDVLCVLLAGLPFAILTSRHTPFQRGVFCNDESIKYPYK EDTIPYALLGGIIIPFSIIVIILGETLSVYCNLLHSNSFIRNNYIATIYK AIGTFLFGAAASQSLTDIAKYSIGRLRPHFLDVCDPDWSKINCSDGYIEY YICRGNAERVKEGRLSFYSGHSSFSMYCMLFVALYLQARMKGDWARLLRP TLQFGLVAVSIYVGLSRVSDYKHHWSDVLTGLIQGALVAILVAVYVSDFF KERTSFKERKEEDSHTTLHETPTTGNHYPSNHQP
Database link: NP_003702 -
Positive control
- WB: HEK-293T cell lysate transfected with pCMV6-ENTRY PPAP2A cDNA. IHC-P: Human kidney, kidney carcinoma, liver, endometrium adenocarcinoma and lymph node tissues.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.30
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol, 1% BSA -
Concentration information loading...
-
Purity
Affinity purified -
Purification notes
Purified from cell culture supernatant by affinity chromatography -
Clonality
Monoclonal -
Clone number
OTI1H4 -
Isotype
IgG1 -
Research areas
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-PPAP2A antibody [OTI1H4] (ab170151)
Paraffin-embedded human lymph node tissue stained for PPAP2A using ab170151 at 1/150 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-PPAP2A antibody [OTI1H4] (ab170151)
Paraffin-embedded human endometrium adenocarcinoma tissue stained for PPAP2A using ab170151 at 1/150 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-PPAP2A antibody [OTI1H4] (ab170151)
Paraffin-embedded human liver tissue stained for PPAP2A using ab170151 at 1/150 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-PPAP2A antibody [OTI1H4] (ab170151)
Paraffin-embedded human kidney carcinoma tissue stained for PPAP2A using ab170151 at 1/150 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-PPAP2A antibody [OTI1H4] (ab170151)
Paraffin-embedded human kidney tissue stained for PPAP2A using ab170151 at 1/150 dilution in immunohistochemical analysis.
-
All lanes : Anti-PPAP2A antibody [OTI1H4] (ab170151) at 1/500 dilution
Lane 1 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate transfected with pCMV6-ENTRY control
Lane 2 : HEK-293T cell lysate transfected with pCMV6-ENTRY PPAP2A cDNA
Lysates/proteins at 5 µg per lane.
Predicted band size: 32 kDa