Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category
Signal Transduction Signaling Pathway G Protein Signaling Small G Proteins Other

Anti-PPAP2A antibody [OTI1H4] (ab170151)

Anti-PPAP2A antibody [OTI1H4] (ab170151)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)

Key features and details

  • Mouse monoclonal [OTI1H4] to PPAP2A
  • Suitable for: WB, IHC-P
  • Reacts with: Human
  • Isotype: IgG1

You may also be interested in

Product image
Anti-FTSJ1 antibody (ab227259)
Product image
Anti-NEK6 antibody [EPR5282] (ab109177)
Product image
Anti-GAB2 (phospho Y643) antibody (ab78262)
Product image
JNK 1/2 (pT183/Y185) ELISA Kit (ab176645)

Overview

  • Product name

    Anti-PPAP2A antibody [OTI1H4]
    See all PPAP2A primary antibodies
  • Description

    Mouse monoclonal [OTI1H4] to PPAP2A
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Guinea pig
  • Immunogen

    Recombinant full length protein corresponding to Human PPAP2A aa 1-284.
    Sequence:

    MFDKTRLPYVALDVLCVLLAGLPFAILTSRHTPFQRGVFCNDESIKYPYK EDTIPYALLGGIIIPFSIIVIILGETLSVYCNLLHSNSFIRNNYIATIYK AIGTFLFGAAASQSLTDIAKYSIGRLRPHFLDVCDPDWSKINCSDGYIEY YICRGNAERVKEGRLSFYSGHSSFSMYCMLFVALYLQARMKGDWARLLRP TLQFGLVAVSIYVGLSRVSDYKHHWSDVLTGLIQGALVAILVAVYVSDFF KERTSFKERKEEDSHTTLHETPTTGNHYPSNHQP


    Database link: NP_003702
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • WB: HEK-293T cell lysate transfected with pCMV6-ENTRY PPAP2A cDNA. IHC-P: Human kidney, kidney carcinoma, liver, endometrium adenocarcinoma and lymph node tissues.
  • General notes

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.30
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol, 1% BSA
  • Concentration information loading...
  • Purity

    Affinity purified
  • Purification notes

    Purified from cell culture supernatant by affinity chromatography
  • Clonality

    Monoclonal
  • Clone number

    OTI1H4
  • Isotype

    IgG1
  • Research areas

    • Signal Transduction
    • Signaling Pathway
    • Lipid Signaling
    • Other
    • Signal Transduction
    • Metabolism
    • Lipid metabolism
    • Cancer
    • Cancer Metabolism
    • Metabolic signaling pathway
    • Metabolism of lipids and lipoproteins
    • Metabolism
    • Pathways and Processes
    • Metabolic signaling pathways
    • Lipid and lipoprotein metabolism
    • Lipid metabolism

Images

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-PPAP2A antibody [OTI1H4] (ab170151)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-PPAP2A antibody [OTI1H4] (ab170151)

    Paraffin-embedded human lymph node tissue stained for PPAP2A using ab170151 at 1/150 dilution in immunohistochemical analysis.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-PPAP2A antibody [OTI1H4] (ab170151)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-PPAP2A antibody [OTI1H4] (ab170151)

    Paraffin-embedded human endometrium adenocarcinoma tissue stained for PPAP2A using ab170151 at 1/150 dilution in immunohistochemical analysis.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-PPAP2A antibody [OTI1H4] (ab170151)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-PPAP2A antibody [OTI1H4] (ab170151)

    Paraffin-embedded human liver tissue stained for PPAP2A using ab170151 at 1/150 dilution in immunohistochemical analysis.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-PPAP2A antibody [OTI1H4] (ab170151)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-PPAP2A antibody [OTI1H4] (ab170151)

    Paraffin-embedded human kidney carcinoma tissue stained for PPAP2A using ab170151 at 1/150 dilution in immunohistochemical analysis.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-PPAP2A antibody [OTI1H4] (ab170151)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-PPAP2A antibody [OTI1H4] (ab170151)

    Paraffin-embedded human kidney tissue stained for PPAP2A using ab170151 at 1/150 dilution in immunohistochemical analysis.

  • Western blot - Anti-PPAP2A antibody [OTI1H4] (ab170151)
    Western blot - Anti-PPAP2A antibody [OTI1H4] (ab170151)
    All lanes : Anti-PPAP2A antibody [OTI1H4] (ab170151) at 1/500 dilution

    Lane 1 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate transfected with pCMV6-ENTRY control
    Lane 2 : HEK-293T cell lysate transfected with pCMV6-ENTRY PPAP2A cDNA

    Lysates/proteins at 5 µg per lane.

    Predicted band size: 32 kDa

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Alternative products to Anti-PPAP2A antibody [OTI1H4] (ab170151)

  •  
  • Product image

    Anti-PPAP2A antibody (ab198280)

    Applications: IHC-P, WB

Clear all

Recently viewed products

  •  
  • Product image

    Anti-TCEA1 antibody [EPR14821] - BSA and Azide free (ab242405)

  •  
  • Product image

    Donkey Anti-Rabbit IgG H&L (Alexa Fluor® 594) (ab150076)

  •  
  • Product image

    Goat Anti-Rat IgG H&L (HRP) (ab205720)

  •  
  • Product image

    Anti-Uroplakin Ib/UPIb antibody [UPK1B/3102] (ab263455)

  •  
  • Product image

    Anti-Progesterone Receptor antibody [SP42] - BSA and Azide free (ab236222)

  •  
  • Product image

    Anti-TMF antibody [EPR10671(B)] - BSA and Azide free (ab249024)

Get resources and offers direct to your inbox Sign up
© 2021 Astana Biomed Group LLP. All rights reserved.