Anti-Plakophilin 2/PKP2 antibody [8H6] (ab151402)
Key features and details
- Mouse monoclonal [8H6] to Plakophilin 2/PKP2
- Suitable for: WB, Flow Cyt
- Reacts with: Human
- Isotype: IgG1
Overview
-
Product name
Anti-Plakophilin 2/PKP2 antibody [8H6]
See all Plakophilin 2/PKP2 primary antibodies -
Description
Mouse monoclonal [8H6] to Plakophilin 2/PKP2 -
Host species
Mouse -
Tested applications
Suitable for: WB, Flow Cytmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human Plakophilin 2/PKP2 aa 1-350.
Sequence:MAAPGAPAEYGYIRTVLGQQILGQLDSSSLALPSEAKLKLAGSSGRGGQT VKSLRIQEQVQQTLARKGRSSVGNGNLHRTSSVPEYVYNLHLVENDFVGG RSPVPKTYDMLKAGTTATYEGRWGRGTAQYSSQKSVEERSLRHPLRRLEI SPDSSPERAHYTHSDYQYSQRSQAGHTLHHQESRRAALLVPPRYARSEIV GVSRAGTTSRQRHFDTYHRQYQHGSVSDTVFDSIPANPALLTYPRPGTSR SMGNLLEKENYLTAGLTVGQVRPLVPLQPVTQNRASRSSWHQSSFHSTRT LREAGPSVAVDSSGRRAHLTVGQAAAGGSGNLLTERSTFTDSQLGNADME
-
General notes
This product was previously labelled as Plakophilin 2
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. -
Storage buffer
Preservative: 0.1% Sodium azide
Constituent: 99% PBS -
Concentration information loading...
-
Purity
Protein A purified -
Clonality
Monoclonal -
Clone number
8H6 -
Myeloma
NS1 -
Isotype
IgG1 -
Research areas
Images
-
Overlay histogram showing HeLa cells stained with ab151402 (red line). The cells were fixed with 80% methanol (5 min) and then permeabilized with 0.1% PBS-Tween for 20 min. The cells were then incubated in 1x PBS / 10% normal goat serum / 0.3M glycine to block non-specific protein-protein interactions followed by the antibody (ab151402, 1μg/1x106 cells) for 30 min at 22°C. The secondary antibody used was Alexa Fluor® 488 goat anti-mouse IgG (H&L) (ab150113) at 1/2000 dilution for 30 min at 22°C. Isotype control antibody (black line) was mouse IgG1 [ICIGG1] (ab91353, 1μg/1x106 cells) used under the same conditions. Unlabelled sample (blue line) was also used as a control. Acquisition of >5,000 events were collected using a 20mW Argon ion laser (488nm) and 525/30 bandpass filter.
-
Anti-Plakophilin 2/PKP2 antibody [8H6] (ab151402) at 1/100 dilution + HaCat Human keratinocyte cells
Predicted band size: 97 kDa
Observed band size: 92 kDa why is the actual band size different from the predicted?