Anti-PDLIM7 antibody (ab86069)
Key features and details
- Rabbit polyclonal to PDLIM7
- Suitable for: WB
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-PDLIM7 antibody
See all PDLIM7 primary antibodies -
Description
Rabbit polyclonal to PDLIM7 -
Host species
Rabbit -
Tested Applications & Species
See all applications and species dataApplication Species WB Human
-
Immunogen
Synthetic peptide: Corresponding to a region between the C terminal residues 407 and 457 of human LIM mineralization protein 1: IDAGDRFLEALGFSWHDTCFVCAICQINLEGKTFYSKKDRPLCKSHAFSH V
-
Positive control
- HeLa whole cell lysate.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. -
Storage buffer
pH: 6.8
Preservative: 0.09% Sodium azide
Constituents: 0.1% BSA, Tris buffered saline -
Concentration information loading... -
Purity
Immunogen affinity purified -
Purification notes
This antibody was affinity purified using an epitope specific to LMP1 immobilized on solid support. The epitope maps to a region between residue 407 and 457 of human LIM mineralization protein 1 using the numbering given in entry NP_005442.2 (GeneID 9260). -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Images
-
Western blot - Anti-PDLIM7 antibody (ab86069)All lanes : Anti-PDLIM7 antibody (ab86069) at 0.04 µg/ml
Lane 1 : HeLa whole cell lysate at 50 µg
Lane 2 : HeLa whole cell lysate at 15 µg
Lane 3 : HeLa whole cell lysate at 5 µg
Developed using the ECL technique.
Predicted band size: 50 kDa
Exposure time: 3 minutes
