Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category

Anti-P2Y13 antibody [2H1G9] (ab175365)

Anti-P2Y13 antibody [2H1G9] (ab175365)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)

Key features and details

  • Mouse monoclonal [2H1G9] to P2Y13
  • Suitable for: WB, Flow Cyt
  • Reacts with: Human
  • Isotype: IgG1

You may also be interested in

Product image
Alexa Fluor® 647 Anti-Histone H3 (di methyl K9) antibody [Y49] (ab279667)
Product image
Anti-ZC3H14 antibody (ab232936)
Product image
Anti-CDCA7L/HR1 antibody (ab238744)
Product image
Anti-Histone H4 (acetyl K91) antibody (ab241118)

Overview

  • Product name

    Anti-P2Y13 antibody [2H1G9]
    See all P2Y13 primary antibodies
  • Description

    Mouse monoclonal [2H1G9] to P2Y13
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, Flow Cytmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human P2Y13 aa 1-49. Expressed in E coli
    Sequence:

    MTAAIRRQRELSILPKVTLEAMNTTVMQGFNRSERCPRDTRIVQLVFPA


    Database link: Q9BPV8
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • HepG2 cells; Human P2Y13 recombinant protein; P2Y13 (aa 1–49)-hIgGFc transfected HEK293 cell lysate.
  • General notes

    Previously labelled as GPCR GPR86. 

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.05% Sodium azide
    Constituent: 99% PBS

    0.5% protein stabilizer
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purified from tissue culture supernatant.
  • Clonality

    Monoclonal
  • Clone number

    2H1G9
  • Isotype

    IgG1
  • Research areas

    • Neuroscience
    • Neurotransmission
    • Receptors / Channels
    • GPCR
    • More GPCR
    • Signal Transduction
    • Signaling Pathway
    • G Protein Signaling
    • GPCR

Images

  • Western blot - Anti-P2Y13 antibody [2H1G9] (ab175365)
    Western blot - Anti-P2Y13 antibody [2H1G9] (ab175365)
    All lanes : Anti-P2Y13 antibody [2H1G9] (ab175365) at 1/500 dilution

    Lane 1 : non transfected HEK293 cell lysate.
    Lane 2 : P2Y13 (aa 1–49)-hIgGFc transfected HEK293 cell lysate.

    Predicted band size: 40 kDa

  • Western blot - Anti-P2Y13 antibody [2H1G9] (ab175365)
    Western blot - Anti-P2Y13 antibody [2H1G9] (ab175365)
    Anti-P2Y13 antibody [2H1G9] (ab175365) at 1/500 dilution + Human P2Y13 recombinant protein

    Predicted band size: 40 kDa



    Expected MW is 31.6 kDa

  • Flow Cytometry - Anti-P2Y13 antibody [2H1G9] (ab175365)
    Flow Cytometry - Anti-P2Y13 antibody [2H1G9] (ab175365)

    Flow cytometric analysis of HepG2 cells labeling P2Y13 using ab175365 at 1/200 dilution (green), and negative control (purple).

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Alternative products to Anti-P2Y13 antibody [2H1G9] (ab175365)

  •  
  • Product image

    Anti-P2Y13 antibody [EPR3698] (ab108444)

    Applications: WB

  •  
  • Product image

    Anti-P2Y13 antibody (ab137481)

    Applications: IHC-P, WB

Clear all

Recently viewed products

  •  
  • Product image

    Anti-NUB1 antibody [EPR10717] (ab178414)

  •  
  • Product image

    Anti-Homeobox protein SIX6 antibody (ab251658)

  •  
  • Product image

    Anti-PDP1/PDP antibody (ab246931)

  •  
  • Product image

    Anti-UBN1 antibody [UBN1G12] (ab50890)

  •  
  • Product image

    Mouse ICAM 1 Antibody Pair - BSA and Azide free (ab256699)

  •  
  • Product image

    Human DDR1 Antibody Pair - BSA and Azide free (ab267687)

Get resources and offers direct to your inbox Sign up
© 2021 Astana Biomed Group LLP. All rights reserved.