Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category
Signal Transduction Signaling Pathway Nuclear Signaling NFkB Pathway

Anti-OTULIN antibody (ab151117)

Price and availability

291 484 ₸

Availability

Order now and get it on Wednesday February 24, 2021

Anti-OTULIN antibody (ab151117)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)

Key features and details

  • Rabbit polyclonal to OTULIN
  • Suitable for: ICC/IF, IHC-P, WB
  • Reacts with: Human
  • Isotype: IgG

You may also be interested in

Product image
HRP Anti-SQSTM1 / p62 antibody [EPR4844] (ab194720)
Product image
Anti-IKB alpha (phospho Y305) antibody (ab24784)
Product image
Human NFKB2 (NFkB p100/NFKB2) knockout HCT116 cell line (ab266883)
Product image
Anti-C18orf32 antibody (ab122677)

Overview

  • Product name

    Anti-OTULIN antibody
    See all OTULIN primary antibodies
  • Description

    Rabbit polyclonal to OTULIN
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human OTULIN aa 60-158 (internal sequence).
    Sequence:

    DEIEKEKELLIHERGASEPRLSVAPEMDIMDYCKKEWRGNTQKATCMKMG YEEVSQKFTSIRRVRGDNYCALRATLFQAMSQAVGLPPWLQDPELMLLP

    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • Human kidney tissue; RT 4, U 251 MG and Human liver lysates.
  • General notes

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol (glycerin, glycerine), 59% PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

    • Signal Transduction
    • Signaling Pathway
    • Nuclear Signaling
    • NFkB Pathway
    • Epigenetics and Nuclear Signaling
    • Ubiquitin & Ubiquitin Like Modifiers
    • Deubiquitination

Images

  • Western blot - Anti-OTULIN antibody (ab151117)
    Western blot - Anti-OTULIN antibody (ab151117)
    All lanes : Anti-OTULIN antibody (ab151117) at 1/100 dilution

    Lane 1 : RT 4 cell lysate
    Lane 2 : U 251 MG cell lysate
    Lane 3 : Human plasma lysate
    Lane 4 : Human liver tissue lysate
    Lane 5 : Human tonsil tissue lysate

    Predicted band size: 40 kDa

  • Immunocytochemistry/ Immunofluorescence - Anti-OTULIN antibody (ab151117)
    Immunocytochemistry/ Immunofluorescence - Anti-OTULIN antibody (ab151117)
    Immunofluorescent staining of Human cell line U-2 OS shows positivity in plasma membrane and mitochondria. Recommended concentration of ab151117 1-4 µg/ml. Cells treated with PFA/Triton X-100.
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-OTULIN antibody (ab151117)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-OTULIN antibody (ab151117)
    Immunohistochemical analysis of paraffin-embedded Human kidney tissue labeling FAM105B with ab151117 at 1/50 dilution.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Alternative products to Anti-OTULIN antibody (ab151117)

  •  
  • Product image

    Anti-OTULIN antibody (ab245652)

    Applications: IP, WB

  •  
  • Product image

    Anti-OTULIN antibody [EPR19841] - BSA and Azide free (ab271992)

    Applications: IP, WB

  •  
  • Product image

    Anti-OTULIN antibody (ab245653)

    Applications: IP

  •  
  • Product image

    Anti-OTULIN antibody [EPR19841] (ab211328)

    Applications: IP, WB

  •  
  • Product image

    Anti-OTULIN antibody (ab114137)

    Applications: WB

Clear all

Recently viewed products

  •  
  • Product image

    Anti-SGT1/ECD antibody (ab246881)

  •  
  • Product image

    Anti-GPx-7 antibody (ab96257)

  •  
  • Product image

    Anti-SAM domain-containing protein 5 antibody (ab204573)

  •  
  • Product image

    Anti-Meckelin antibody (ab238691)

  •  
  • Product image

    Anti-TopBP1 antibody (ab105109)

  •  
  • Product image

    Anti-GRP78 BiP antibody (ab89789)

Get resources and offers direct to your inbox Sign up
© 2021 Astana Biomed Group LLP. All rights reserved.