Anti-OTULIN antibody (ab151117)
Key features and details
- Rabbit polyclonal to OTULIN
- Suitable for: ICC/IF, IHC-P, WB
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-OTULIN antibody
See all OTULIN primary antibodies -
Description
Rabbit polyclonal to OTULIN -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IF, IHC-P, WBmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat -
Immunogen
Recombinant fragment corresponding to Human OTULIN aa 60-158 (internal sequence).
Sequence:DEIEKEKELLIHERGASEPRLSVAPEMDIMDYCKKEWRGNTQKATCMKMG YEEVSQKFTSIRRVRGDNYCALRATLFQAMSQAVGLPPWLQDPELMLLP
-
Positive control
- Human kidney tissue; RT 4, U 251 MG and Human liver lysates.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol (glycerin, glycerine), 59% PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Images
-
All lanes : Anti-OTULIN antibody (ab151117) at 1/100 dilution
Lane 1 : RT 4 cell lysate
Lane 2 : U 251 MG cell lysate
Lane 3 : Human plasma lysate
Lane 4 : Human liver tissue lysate
Lane 5 : Human tonsil tissue lysate
Predicted band size: 40 kDa
-
Immunofluorescent staining of Human cell line U-2 OS shows positivity in plasma membrane and mitochondria. Recommended concentration of ab151117 1-4 µg/ml. Cells treated with PFA/Triton X-100.
-
Immunohistochemical analysis of paraffin-embedded Human kidney tissue labeling FAM105B with ab151117 at 1/50 dilution.