Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category
Signal Transduction Cytoskeleton / ECM Cytoskeleton Motor Proteins Myosin

Anti-non-muscle Myosin IIA antibody [2B3] (ab55456)

Price and availability

284 784 ₸

Availability

Order now and get it on Tuesday March 02, 2021

Anti-non-muscle Myosin IIA antibody [2B3] (ab55456)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)

Key features and details

  • Mouse monoclonal [2B3] to non-muscle Myosin IIA
  • Suitable for: WB, IHC-P, Flow Cyt, ICC/IF
  • Knockout validated
  • Reacts with: Human, Recombinant fragment
  • Isotype: IgG2b

You may also be interested in

Product image
Recombinant Human heavy chain Myosin/MYH3 protein (ab114308)
Product image
Anti-MYO5B antibody - N-terminal (ab190096)
Product image
Anti-non-muscle Myosin IIA antibody [EPR22933-9] (ab238131)
Product image
Anti-non-muscle Myosin IIA antibody (ab75590)

Overview

  • Product name

    Anti-non-muscle Myosin IIA antibody [2B3]
    See all non-muscle Myosin IIA primary antibodies
  • Description

    Mouse monoclonal [2B3] to non-muscle Myosin IIA
  • Host species

    Mouse
  • Tested Applications & Species

    Application Species
    Flow Cyt
    Human
    ICC/IF
    Human
    IHC-P
    Human
    WB
    Human
    Recombinant fragment
    See all applications and species data
  • Immunogen

    Recombinant fragment (GST-tag) corresponding to Human non-muscle Myosin IIA aa 1871-1960. MW of the GST tag alone is 26 KDa.
    Sequence:

    RLKQLKRQLEEAEEEAQRANASRRKLQRELEDATETADAMNREVSSLKNK LRRGDLPFVVPRRMARKGAGDGSDEEVDGKADGAEAKPAE


    Database link: P35579
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • WB: HAP1, HeLa ,HEK293 cell lysate; human kidney tissue lysate. ICC/IF: HeLa, MCF7 cells. IHC-P: Human kidney tissue. Flow cyt: HEK293 cells.
  • General notes

    Abcam is committed to meeting high standards of ethical manufacturing and has decided to discontinue this product by 01st December 2020 as it has been generated by the ascites method. We recommend ab138498 as an alternative product. We are sorry for any inconvenience this may cause.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Constituent: PBS
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Monoclonal
  • Clone number

    2B3
  • Isotype

    IgG2b
  • Light chain type

    kappa
  • Research areas

    • Signal Transduction
    • Cytoskeleton / ECM
    • Cytoskeleton
    • Motor Proteins
    • Myosin

Images

  • Western blot - Anti-non-muscle Myosin IIA antibody (ab55456)
    Western blot - Anti-non-muscle Myosin IIA antibody (ab55456)

    Lane 1: Wild-type HAP1 cell lysate (20 µg)
    Lane 2: non-muscle Myosin IIA knockout HAP1 cell lysate (20 µg)
    Lane 3: HeLa cell lysate (20 µg)
    Lane 4: HEK293 cell lysate (20 µg)
    Lanes 1 - 4: Merged signal (red and green). Green - ab55456 observed at 230 kDa. Red - loading control, ab18251, observed at 52 kDa.

    ab55456 was shown to specifically react with non-muscle Myosin IIA when non-muscle Myosin IIA knockout samples were used. Wild-type and non-muscle Myosin IIA knockout samples were subjected to SDS-PAGE. ab55456 at a concentration of 1 µg/ml and ab18251 (loading control to alpha Tubulin) at a dilution of 1/1000 were incubated overnight at 4°C. Blots were developed withGoat anti-Mouse IgG H&L (IRDye® 800CW) preadsorbed (ab216772) and Goat Anti-Rabbit IgG H&L (IRDye® 680RD) preadsorbed (ab216777) secondary antibodies at 1/10000 dilution for 1 hour at room temperature before imaging.

  • Immunocytochemistry/ Immunofluorescence - Anti-non-muscle Myosin IIA antibody [2B3] (ab55456)
    Immunocytochemistry/ Immunofluorescence - Anti-non-muscle Myosin IIA antibody [2B3] (ab55456)

    Immunofluorecence analysis of HeLa (human epithelial cell line from cervix adenocarcinoma) cells labeling non-muscle Myosin IIA (Green) using ab55456 at 10 µg/ml in ICC/IF analysis.

  • Immunocytochemistry/ Immunofluorescence - Anti-non-muscle Myosin IIA antibody [2B3] (ab55456)
    Immunocytochemistry/ Immunofluorescence - Anti-non-muscle Myosin IIA antibody [2B3] (ab55456) Image from Bailey CK et al., J Biol Chem. 2012 Jun 1;287(23):19472-86. Epub 2012 Apr 11. Fig 10.; doi: 10.1074/jbc.M112.345728; June 1, 2012 The Journal of Biological Chemistry, 287, 19472-19486.
    Immunofluorescence analysis of plakoglobin-knocked down MCF7 cells, staining non-muscle Myosin IIA with ab55456.

    Cells were fixed with formaldehyde, permeabilized with 0.2% Triton X-100 and blocked in 5% goat serum. Samples were incubated with primary antibody overnight at 4°C. An AlexaFluor®-conjugated anti-mouse IgG was used as the secondary antibody.
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-non-muscle Myosin IIA antibody (ab55456)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-non-muscle Myosin IIA antibody (ab55456)

    Immunohistochemical analysis of paraffin-embedded human kidney tissue labeling non-muscle Myosin llA with ab55456 at 0.5 µg/ml.

  • Flow Cytometry - Anti-non-muscle Myosin IIA antibody (ab55456)
    Flow Cytometry - Anti-non-muscle Myosin IIA antibody (ab55456)
    Overlay histogram showing HEK293 cells stained with ab55456 (red line). The cells were fixed with 4% paraformaldehyde (10 min) and then permeabilized with 0.1% PBS-Tween for 20 min. The cells were then incubated in 1x PBS / 10% normal goat serum / 0.3M glycine to block non-specific protein-protein interactions followed by the antibody (ab55456, 1µg/1x106 cells) for 30 min at 22°C. The secondary antibody used was DyLight® 488 goat anti-mouse IgG (H+L) (ab96879) at 1/500 dilution for 30 min at 22°C. Isotype control antibody (black line) was mouse IgG2b [PLPV219] (ab91366, 2µg/1x106 cells) used under the same conditions. Acquisition of >5,000 events was performed. This antibody gave a positive signal in HEK293 cells fixed with 100% methanol (5 min)/permeabilized in 0.1% PBS-Tween used under the same conditions.

  • Immunocytochemistry/ Immunofluorescence - Anti-non-muscle Myosin IIA antibody (ab55456)
    Immunocytochemistry/ Immunofluorescence - Anti-non-muscle Myosin IIA antibody (ab55456)
    ICC/IF image of ab55456 stained HeLa cells. The cells were 100% methanol fixed (5 min) and then incubated in 1%BSA / 10% normal goat serum / 0.3M glycine in 0.1% PBS-Tween for 1h to permeabilise the cells and block non-specific protein-protein interactions. The cells were then incubated with the antibody (ab55456, 1µg/ml) overnight at +4°C. The secondary antibody (green) was Alexa Fluor® 488 goat anti-mouse IgG (H+L) used at a 1/1000 dilution for 1h. Alexa Fluor® 594 WGA was used to label plasma membranes (red) at a 1/200 dilution for 1h. DAPI was used to stain the cell nuclei (blue) at a concentration of 1.43µM.

  • Western blot - Anti-non-muscle Myosin IIA antibody (ab55456)
    Western blot - Anti-non-muscle Myosin IIA antibody (ab55456)
    Western blot against tagged recombinant protein immunogen using ab55456 non-muscle Myosin IIA antibody at 1ug/ml. Predicted band size of immunogen is 33 kDa
  • - Anti-non-muscle Myosin IIA antibody (ab55456)
    - Anti-non-muscle Myosin IIA antibody (ab55456)
    Anti-non-muscle Myosin IIA antibody [2B3] (ab55456) + HeLa
  • Western blot - Anti-non-muscle Myosin IIA antibody [2B3] (ab55456)
    Western blot - Anti-non-muscle Myosin IIA antibody [2B3] (ab55456)
    Anti-non-muscle Myosin IIA antibody [2B3] (ab55456) at 5 µg/ml + Human kidney tissue lysate

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Clear all

Recently viewed products

  •  
  • Product image

    Anti-Smad2 (phospho T8) + Smad3 (phospho T8) antibody [EPR23682-64] (ab254407)

  •  
  • Product image

    Anti-non-muscle Myosin IIA antibody (ab89837)

  •  
  • Product image

    Anti-E3 ubiquitin-protein ligase MUL1 antibody [EPR20241] (ab209263)

  •  
  • Product image

    Anti-FOXA1 antibody [EPR10881] - BSA and Azide free (ab236011)

  •  
  • Product image

    Anti-Involucrin antibody [EPR13060(N)] - C-terminal (ab184969)

  •  
  • Product image

    Anti-YB1 antibody [EP2708Y] - BSA and Azide free (ab239875)

Get resources and offers direct to your inbox Sign up
© 2021 Astana Biomed Group LLP. All rights reserved.