Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category
Signal Transduction Metabolism Vitamins / Minerals

Anti-MMAB antibody [OTI2G5] (ab123916)

Anti-MMAB antibody [OTI2G5] (ab123916)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)

Key features and details

  • Mouse monoclonal [OTI2G5] to MMAB
  • Suitable for: WB, IHC-P, Flow Cyt
  • Reacts with: Human
  • Isotype: IgG1

You may also be interested in

Product image
Recombinant Human PPCDC protein (ab101184)
Product image
Recombinant Mouse Vitamin D Binding protein (His tag) (ab235708)
Product image
Human TXNL1 knockout HEK-293T cell line (ab266413)
Product image
Anti-ATP7b antibody - C-terminal (ab217299)

Overview

  • Product name

    Anti-MMAB antibody [OTI2G5]
    See all MMAB primary antibodies
  • Description

    Mouse monoclonal [OTI2G5] to MMAB
  • Host species

    Mouse
  • Tested Applications & Species

    Application Species
    Flow Cyt
    Human
    IHC-P
    Human
    WB
    Human
    See all applications and species data
  • Immunogen

    Recombinant full length protein corresponding to Human MMAB aa 33-250. (NP_443077) produced in HEK293T cell.
    Sequence:

    QSRGPQGVEDGDRPQPSSKTPRIPKIYTKTGDKGFSSTFTGERRPKDDQV FEAVGTTDELSSAIGFALELVTEKGHTFAEELQKIQCTLQDVGSALATPC SSAREAHLKYTTFKAGPILELEQWIDKYTSQLPPLTAFILPSGGKISSAL HFCRAVCRRAERRVVPLVQMGETDANVAKFLNRLSDYLFTLARYAAMKEG NQEKIYMKNDPSAESEGL


    Database link: Q96EY8
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • WB: HEK-293T cells transfected with pCMV6-ENTRY MMAB IHC-P: Human Kidney tissue, carcinoma of Human kidney tissue, Human liver tissue, carcinoma of Human prostate tissue, Human lymph node tissue Flow Cyt: Jurkat cells and transfected HEK-293T cells
  • General notes

    The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing the problem with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation.

    One factor contributing to the crisis is the use of antibodies that are not suitable. This can lead to misleading results and the use of incorrect data informing project assumptions and direction. To help address this challenge, we have introduced an application and species grid on our primary antibody datasheets to make it easy to simplify identification of the right antibody for your needs.

    Learn more here.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.30
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 1% BSA, 50% Glycerol
  • Concentration information loading...
  • Purity

    Affinity purified
  • Purification notes

    Purified from cell culture supernatant by affinity chromatography
  • Clonality

    Monoclonal
  • Clone number

    OTI2G5
  • Isotype

    IgG1
  • Research areas

    • Signal Transduction
    • Metabolism
    • Vitamins / Minerals
    • Metabolism
    • Pathways and Processes
    • Cofactors, Vitamins / minerals
    • Vitamins / minerals
    • Metabolism
    • Types of disease
    • Cancer

Images

  • Western blot - Anti-MMAB antibody [OTI2G5] (ab123916)
    Western blot - Anti-MMAB antibody [OTI2G5] (ab123916)
    All lanes : Anti-MMAB antibody [OTI2G5] (ab123916) at 1/2000 dilution

    Lane 1 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate transfected with pCMV6-ENTRY control
    Lane 2 : HEK-293T cells transfected with pCMV6-ENTRY MMAB

    Lysates/proteins at 5 µg per lane.

    Predicted band size: 27 kDa

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-MMAB antibody [OTI2G5] (ab123916)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-MMAB antibody [OTI2G5] (ab123916)

    Paraffin-embedded human kidney tissue stained for MMAB using ab123916 at 1/150 dilution in immunohistochemical analysis.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-MMAB antibody [OTI2G5] (ab123916)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-MMAB antibody [OTI2G5] (ab123916)

    Paraffin-embedded human kidney carcinoma tissue stained for MMAB using ab123916 at 1/150 dilution in immunohistochemical analysis.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-MMAB antibody [OTI2G5] (ab123916)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-MMAB antibody [OTI2G5] (ab123916)

    Paraffin-embedded human liver tissue stained for MMAB using ab123916 at 1/150 dilution in immunohistochemical analysis.

     

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-MMAB antibody [OTI2G5] (ab123916)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-MMAB antibody [OTI2G5] (ab123916)

    Paraffin-embedded human prostate carcinoma tissue stained for MMAB using ab123916 at 1/150 dilution in immunohistochemical analysis.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-MMAB antibody [OTI2G5] (ab123916)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-MMAB antibody [OTI2G5] (ab123916)

    Paraffin-embedded human lymph node tissue stained for MMAB using ab123916 at 1/150 dilution in immunohistochemical analysis.

  • Flow Cytometry - Anti-MMAB antibody [OTI2G5] (ab123916)
    Flow Cytometry - Anti-MMAB antibody [OTI2G5] (ab123916)

    Flow cytometric analysis of HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cells with either pCMV6-ENTRY MMAB (Red), or pCMV6-ENTRY control plasmid (Blue), stained using ab123916 at 1/100 dilution.

     

  • Flow Cytometry - Anti-MMAB antibody [OTI2G5] (ab123916)
    Flow Cytometry - Anti-MMAB antibody [OTI2G5] (ab123916)

    Flow cytometric analysis of jurkat (human T cell leukemia cell line from peripheral blood) cells stained for MMAB (Red) using ab123916 at 1/100 dilution, compared to a nonspecific negative control antibody (Blue).

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Alternative products to Anti-MMAB antibody [OTI2G5] (ab123916)

  •  
  • Product image

    Anti-MMAB antibody (ab154156)

    Applications: IHC-P, WB

  •  
  • Product image

    Anti-MMAB antibody [EPR8695] (ab174831)

    Applications: ICC/IF, WB

  •  
  • Product image

    Anti-MMAB antibody (ab243596)

    Applications: ICC/IF, IHC-P, WB

Clear all

Recently viewed products

  •  
  • Product image

    Anti-INPP4A antibody [EP3425(2)] (ab109622)

  •  
  • Product image

    Anti-STAT5a + STAT5b antibody [EPR16671-40] (ab194898)

  •  
  • Product image

    Anti-AE binding protein 1 antibody [EPR7733(2)] (ab168355)

  •  
  • Product image

    Anti-Carbonic Anhydrase 12/CA12 antibody (ab230515)

  •  
  • Product image

    Anti-Septin 2 antibody - C-terminal (ab185998)

  •  
  • Product image

    Anti-Calreticulin 3 antibody (ab254913)

Get resources and offers direct to your inbox Sign up
© 2021 Astana Biomed Group LLP. All rights reserved.