Anti-MMAB antibody [OTI2G5] (ab123916)
![Anti-MMAB antibody [OTI2G5] (ab123916)](https://www.abcam.com/ps/products/123/ab123916/Images/MMAB-Primary-antibodies-ab123916-2.jpg "Anti-MMAB antibody [OTI2G5] (ab123916)")
Key features and details
- Mouse monoclonal [OTI2G5] to MMAB
- Suitable for: WB, IHC-P, Flow Cyt
- Reacts with: Human
- Isotype: IgG1
Overview
-
Product name
Anti-MMAB antibody [OTI2G5]
See all MMAB primary antibodies -
Description
Mouse monoclonal [OTI2G5] to MMAB -
Host species
Mouse -
Tested Applications & Species
See all applications and species dataApplication Species Flow Cyt HumanIHC-P HumanWB Human
-
Immunogen
Recombinant full length protein corresponding to Human MMAB aa 33-250. (NP_443077) produced in HEK293T cell.
Sequence:QSRGPQGVEDGDRPQPSSKTPRIPKIYTKTGDKGFSSTFTGERRPKDDQV FEAVGTTDELSSAIGFALELVTEKGHTFAEELQKIQCTLQDVGSALATPC SSAREAHLKYTTFKAGPILELEQWIDKYTSQLPPLTAFILPSGGKISSAL HFCRAVCRRAERRVVPLVQMGETDANVAKFLNRLSDYLFTLARYAAMKEG NQEKIYMKNDPSAESEGL
Database link: Q96EY8 -
Positive control
- WB: HEK-293T cells transfected with pCMV6-ENTRY MMAB IHC-P: Human Kidney tissue, carcinoma of Human kidney tissue, Human liver tissue, carcinoma of Human prostate tissue, Human lymph node tissue Flow Cyt: Jurkat cells and transfected HEK-293T cells
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing the problem with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation.
One factor contributing to the crisis is the use of antibodies that are not suitable. This can lead to misleading results and the use of incorrect data informing project assumptions and direction. To help address this challenge, we have introduced an application and species grid on our primary antibody datasheets to make it easy to simplify identification of the right antibody for your needs.
Learn more here.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.30
Preservative: 0.02% Sodium azide
Constituents: PBS, 1% BSA, 50% Glycerol -
Concentration information loading... -
Purity
Affinity purified -
Purification notes
Purified from cell culture supernatant by affinity chromatography -
Clonality
Monoclonal -
Clone number
OTI2G5 -
Isotype
IgG1 -
Research areas
Images
-
Western blot - Anti-MMAB antibody [OTI2G5] (ab123916)All lanes : Anti-MMAB antibody [OTI2G5] (ab123916) at 1/2000 dilution
Lane 1 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate transfected with pCMV6-ENTRY control
Lane 2 : HEK-293T cells transfected with pCMV6-ENTRY MMAB
Lysates/proteins at 5 µg per lane.
Predicted band size: 27 kDa
-
![Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-MMAB antibody [OTI2G5] (ab123916)](https://www.abcam.com/ps/products/123/ab123916/Images/MMAB-Primary-antibodies-ab123916-3.jpg)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-MMAB antibody [OTI2G5] (ab123916)Paraffin-embedded human kidney tissue stained for MMAB using ab123916 at 1/150 dilution in immunohistochemical analysis.
-
![Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-MMAB antibody [OTI2G5] (ab123916)](https://www.abcam.com/ps/products/123/ab123916/Images/MMAB-Primary-antibodies-ab123916-4.jpg)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-MMAB antibody [OTI2G5] (ab123916)Paraffin-embedded human kidney carcinoma tissue stained for MMAB using ab123916 at 1/150 dilution in immunohistochemical analysis.
-
![Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-MMAB antibody [OTI2G5] (ab123916)](https://www.abcam.com/ps/products/123/ab123916/Images/MMAB-Primary-antibodies-ab123916-5.jpg)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-MMAB antibody [OTI2G5] (ab123916)Paraffin-embedded human liver tissue stained for MMAB using ab123916 at 1/150 dilution in immunohistochemical analysis.
-
![Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-MMAB antibody [OTI2G5] (ab123916)](https://www.abcam.com/ps/products/123/ab123916/Images/MMAB-Primary-antibodies-ab123916-6.jpg)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-MMAB antibody [OTI2G5] (ab123916)Paraffin-embedded human prostate carcinoma tissue stained for MMAB using ab123916 at 1/150 dilution in immunohistochemical analysis.
-
![Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-MMAB antibody [OTI2G5] (ab123916)](https://www.abcam.com/ps/products/123/ab123916/Images/MMAB-Primary-antibodies-ab123916-7.jpg)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-MMAB antibody [OTI2G5] (ab123916)Paraffin-embedded human lymph node tissue stained for MMAB using ab123916 at 1/150 dilution in immunohistochemical analysis.
-
![Flow Cytometry - Anti-MMAB antibody [OTI2G5] (ab123916)](https://www.abcam.com/ps/products/123/ab123916/Images/MMAB-Primary-antibodies-ab123916-8.jpg)
Flow Cytometry - Anti-MMAB antibody [OTI2G5] (ab123916)Flow cytometric analysis of HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cells with either pCMV6-ENTRY MMAB (Red), or pCMV6-ENTRY control plasmid (Blue), stained using ab123916 at 1/100 dilution.
-
![Flow Cytometry - Anti-MMAB antibody [OTI2G5] (ab123916)](https://www.abcam.com/ps/products/123/ab123916/Images/MMAB-Primary-antibodies-ab123916-9.jpg)
Flow Cytometry - Anti-MMAB antibody [OTI2G5] (ab123916)Flow cytometric analysis of jurkat (human T cell leukemia cell line from peripheral blood) cells stained for MMAB (Red) using ab123916 at 1/100 dilution, compared to a nonspecific negative control antibody (Blue).
