Anti-Mitofusin 2 antibody [6A8] (ab56889)
Key features and details
- Mouse monoclonal [6A8] to Mitofusin 2
- Suitable for: WB, IHC-P, ICC/IF, Flow Cyt
- Reacts with: Mouse, Human
- Isotype: IgG2a
Overview
-
Product name
Anti-Mitofusin 2 antibody [6A8]
See all Mitofusin 2 primary antibodies -
Description
Mouse monoclonal [6A8] to Mitofusin 2 -
Host species
Mouse -
Tested Applications & Species
See all applications and species dataApplication Species Flow Cyt HumanICC/IF MouseIHC-P HumanWB Human -
Immunogen
Recombinant fragment corresponding to Human Mitofusin 2 aa 661-757 (C terminal).
Sequence:FKRQFVEHASEKLQLVISYTGSNCSHQVQQELSGTFAHLCQQVDVTRENL EQEIAAMNKKIEVLDSLQSKAKLLRNKAGWLDSELNMFTHQYLQPSR
Database link: O95140 -
General notes
This product was changed from ascites to tissue culture supernatant on 15 May 2019. Please note that the dilutions may need to be adjusted accordingly. If you have any questions, please do not hesitate to contact our scientific support team.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.4 -
Concentration information loading... -
Purity
Protein A purified -
Purification notes
Purified by protein A from TCS. -
Clonality
Monoclonal -
Clone number
6A8 -
Isotype
IgG2a -
Light chain type
kappa -
Research areas
Images
-
Anti-Mitofusin 2 antibody [6A8] (ab56889) at 1 µg/ml + HeLa cell lysate at 25 µg
Predicted band size: 86 kDaThis image was generated using the ascites version of the product.
-
ab56889 staining mitofusin 2 in MEF1 cells treated with nigericin Na+ salt (ab120494), by ICC/IF. Decrease in mitofusin 2 expression correlates with increased concentration of nigericin Na+ salt, as described in literature.
The cells were incubated at 37°C for 3h in media containing different concentrations of ab120494 (nigericin Na+ salt) in DMSO, fixed with 100% methanol for 5 minutes at -20°C and blocked with PBS containing 10% goat serum, 0.3 M glycine, 1% BSA and 0.1% tween for 2h at room temperature. Staining of the treated cells with ab56889 (10 µg/ml) was performed overnight at 4°C in PBS containing 1% BSA and 0.1% tween. A DyLight® 488 goat anti-mouse polyclonal antibody (ab96879) at 1/250 dilution was used as the secondary antibody. Nuclei were counterstained with DAPI and are shown in blue.This image was generated using the ascites version of the product.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Mitofusin 2 antibody [6A8] (ab56889)Mitofusin 2 antibody (ab56889) used in immunohistochemistry at 3ug/ml on formalin fixed and paraffin embedded human kidney.
This image was generated using the ascites version of the product.
-
Overlay histogram showing HEK293 cells stained with ab56889 (red line). The cells were fixed with 80% methanol (5 min) and then permeabilized with 0.1% PBS-Tween for 20 min. The cells were then incubated in 1x PBS / 10% normal goat serum / 0.3M glycine to block non-specific protein-protein interactions followed by the antibody (ab56889, 1µg/1x106 cells) for 30 min at 22°C. The secondary antibody used was DyLight® 488 goat anti-mouse IgG (H+L) (ab96879) at 1/500 dilution for 30 min at 22ºC. Isotype control antibody (black line) was mouse IgG2a [ICIGG2A] (ab91361, 1µg/1x106 cells) used under the same conditions. Acquisition of >5,000 events was performed. This antibody gave a positive signal in HEK293 cells fixed with 4% paraformaldehyde (10 min)/permeabilized in 0.1% PBS-Tween used under the same conditions.
This image was generated using the ascites version of the product.
-
ab56889 staining mitofusin2 in MEF1 cells treated with valinomycin from Streptomyces fulvissimus (ab120852), by ICC/IF. Decrease in mitofusin2 expression with increased concentration of withaferin valinomycin from Streptomyces fulvissimus, as described in literature.
The cells were incubated at 37°C for 3h in media containing different concentrations of ab120852 (valinomycin from Streptomyces fulvissimus) in DMSO, fixed with 100% methanol for 5 minutes at -20°C and blocked with PBS containing 10% goat serum, 0.3 M glycine, 1% BSA and 0.1% tween for 2h at room temperature. Staining of the treated cells with ab56889 (10 µg/ml) was performed overnight at 4°C in PBS containing 1% BSA and 0.1% tween. A DyLight® 488 goat anti-mouse polyclonal antibody (ab96879) at 1/250 dilution was used as the secondary antibody. Nuclei were counterstained with DAPI and are shown in blue.This image was generated using the ascites version of the product.

