Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category

Anti-Mitofusin 2 antibody [6A8] (ab56889)

Price and availability

381 945 ₸

Availability

Order now and get it on Tuesday March 02, 2021

Anti-Mitofusin 2 antibody [6A8] (ab56889)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)

Key features and details

  • Mouse monoclonal [6A8] to Mitofusin 2
  • Suitable for: WB, IHC-P, ICC/IF, Flow Cyt
  • Reacts with: Mouse, Human
  • Isotype: IgG2a

You may also be interested in

Product image
Mouse Endocan ELISA Kit (ab236716)
ROX azide, 5- isomer (DMSO solution), Red-emitting fluorescent labeling reagent (ab235031)
Product image
Anti-TRAIL antibody (ab231265)
Product image
Human CAT (Catalase) knockout HeLa cell pellet (ab278971)

Overview

  • Product name

    Anti-Mitofusin 2 antibody [6A8]
    See all Mitofusin 2 primary antibodies
  • Description

    Mouse monoclonal [6A8] to Mitofusin 2
  • Host species

    Mouse
  • Tested Applications & Species

    Application Species
    Flow Cyt
    Human
    ICC/IF
    Mouse
    IHC-P
    Human
    WB
    Human
    See all applications and species data
  • Immunogen

    Recombinant fragment corresponding to Human Mitofusin 2 aa 661-757 (C terminal).
    Sequence:

    FKRQFVEHASEKLQLVISYTGSNCSHQVQQELSGTFAHLCQQVDVTRENL EQEIAAMNKKIEVLDSLQSKAKLLRNKAGWLDSELNMFTHQYLQPSR


    Database link: O95140
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • General notes

    This product was changed from ascites to tissue culture supernatant on 15 May 2019. Please note that the dilutions may need to be adjusted accordingly. If you have any questions, please do not hesitate to contact our scientific support team.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
  • Concentration information loading...
  • Purity

    Protein A purified
  • Purification notes

    Purified by protein A from TCS.
  • Clonality

    Monoclonal
  • Clone number

    6A8
  • Isotype

    IgG2a
  • Light chain type

    kappa
  • Research areas

    • Tags & Cell Markers
    • Subcellular Markers
    • Organelles
    • Mitochondria
    • Cell Biology
    • Apoptosis
    • Mitochondrial
    • Signal Transduction
    • Metabolism
    • Mitochondrial
    • Neuroscience
    • Neurology process
    • Neurodegenerative disease
    • Other
    • Metabolism
    • Pathways and Processes
    • Mitochondrial Metabolism
    • Mitochondrial markers
    • Metabolism
    • Pathways and Processes
    • Mitochondrial Metabolism
    • Mitophagy fission and fusion
    • Metabolism
    • Pathways and Processes
    • Metabolism processes
    • Apoptosis
    • Metabolism
    • Types of disease
    • Cancer
    • Cancer
    • Cell Death
    • Apoptosis
    • Mitochondrial
    • Cancer
    • Cell Death
    • Apoptosis
    • Metabolism

Images

  • Western blot - Anti-Mitofusin 2 antibody [6A8] (ab56889)
    Western blot - Anti-Mitofusin 2 antibody [6A8] (ab56889)
    Anti-Mitofusin 2 antibody [6A8] (ab56889) at 1 µg/ml + HeLa cell lysate at 25 µg

    Predicted band size: 86 kDa



    This image was generated using the ascites version of the product.

  • Immunocytochemistry/ Immunofluorescence - Anti-Mitofusin 2 antibody [6A8] (ab56889)
    Immunocytochemistry/ Immunofluorescence - Anti-Mitofusin 2 antibody [6A8] (ab56889)

    ab56889 staining mitofusin 2 in MEF1 cells treated with nigericin Na+ salt (ab120494), by ICC/IF. Decrease in mitofusin 2 expression correlates with increased concentration of nigericin Na+ salt, as described in literature.
    The cells were incubated at 37°C for 3h in media containing different concentrations of ab120494 (nigericin Na+ salt) in DMSO, fixed with 100% methanol for 5 minutes at -20°C and blocked with PBS containing 10% goat serum, 0.3 M glycine, 1% BSA and 0.1% tween for 2h at room temperature. Staining of the treated cells with ab56889 (10 µg/ml) was performed overnight at 4°C in PBS containing 1% BSA and 0.1% tween. A DyLight® 488 goat anti-mouse polyclonal antibody (ab96879) at 1/250 dilution was used as the secondary antibody. Nuclei were counterstained with DAPI and are shown in blue.

    This image was generated using the ascites version of the product.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Mitofusin 2 antibody [6A8] (ab56889)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Mitofusin 2 antibody [6A8] (ab56889)

    Mitofusin 2 antibody (ab56889) used in immunohistochemistry at 3ug/ml on formalin fixed and paraffin embedded human kidney.

    This image was generated using the ascites version of the product.

  • Flow Cytometry - Anti-Mitofusin 2 antibody [6A8] (ab56889)
    Flow Cytometry - Anti-Mitofusin 2 antibody [6A8] (ab56889)

    Overlay histogram showing HEK293 cells stained with ab56889 (red line). The cells were fixed with 80% methanol (5 min) and then permeabilized with 0.1% PBS-Tween for 20 min. The cells were then incubated in 1x PBS / 10% normal goat serum / 0.3M glycine to block non-specific protein-protein interactions followed by the antibody (ab56889, 1µg/1x106 cells) for 30 min at 22°C. The secondary antibody used was DyLight® 488 goat anti-mouse IgG (H+L) (ab96879) at 1/500 dilution for 30 min at 22ºC. Isotype control antibody (black line) was mouse IgG2a [ICIGG2A] (ab91361, 1µg/1x106 cells) used under the same conditions. Acquisition of >5,000 events was performed. This antibody gave a positive signal in HEK293 cells fixed with 4% paraformaldehyde (10 min)/permeabilized in 0.1% PBS-Tween used under the same conditions.

    This image was generated using the ascites version of the product.

  • Immunocytochemistry/ Immunofluorescence - Anti-Mitofusin 2 antibody [6A8] (ab56889)
    Immunocytochemistry/ Immunofluorescence - Anti-Mitofusin 2 antibody [6A8] (ab56889)

    ab56889 staining mitofusin2 in MEF1 cells treated with valinomycin from Streptomyces fulvissimus (ab120852), by ICC/IF. Decrease in mitofusin2 expression with increased concentration of withaferin valinomycin from Streptomyces fulvissimus, as described in literature.
    The cells were incubated at 37°C for 3h in media containing different concentrations of ab120852 (valinomycin from Streptomyces fulvissimus) in DMSO, fixed with 100% methanol for 5 minutes at -20°C and blocked with PBS containing 10% goat serum, 0.3 M glycine, 1% BSA and 0.1% tween for 2h at room temperature. Staining of the treated cells with ab56889 (10 µg/ml) was performed overnight at 4°C in PBS containing 1% BSA and 0.1% tween. A DyLight® 488 goat anti-mouse polyclonal antibody (ab96879) at 1/250 dilution was used as the secondary antibody. Nuclei were counterstained with DAPI and are shown in blue.

    This image was generated using the ascites version of the product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Alternative products to Anti-Mitofusin 2 antibody [6A8] (ab56889)

  •  
  • Product image

    Anti-Mitofusin 2 antibody (ab218162)

    Applications: IHC-P

  •  
  • Product image

    Anti-Mitofusin 2 antibody [N153/5] (ab186317)

    Applications: ICC/IF, WB

  •  
  • Product image

    Anti-Mitofusin 2 antibody [NIAR164] (ab124773)

    Applications: ICC/IF, IHC-P, WB

  •  
  • FITC Anti-Mitofusin 2 antibody [N153/5] (ab186319)

    Applications:

  •  
  • Product image

    Anti-Mitofusin 2 antibody [EPR19796] (ab205236)

    Applications: Flow Cyt, ICC/IF, IP, WB

  •  
  • Product image

    Anti-Mitofusin 2 antibody [NIAR164] - BSA and Azide free (ab219730)

    Applications: ICC/IF, IHC-P, WB

  •  
  • Product image

    Anti-Mitofusin 2 antibody (ab50838)

    Applications: WB

  •  
  • Product image

    Anti-Mitofusin 2 antibody (ab50843)

    Applications: WB

Clear all

Recently viewed products

  •  
  • Product image

    PE Anti-IL-13 antibody [13A] (ab95576)

  •  
  • Luzindole (N-0774), melatonin receptor antagonist (ab145232)

Get resources and offers direct to your inbox Sign up
© 2021 Astana Biomed Group LLP. All rights reserved.