Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category
Signal Transduction Signaling Pathway G Protein Signaling Small G Proteins Other

Anti-MCM7/PRL antibody - BSA and Azide free (ab179904)

Anti-MCM7/PRL antibody - BSA and Azide free (ab179904)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)

Key features and details

  • Rabbit polyclonal to MCM7/PRL - BSA and Azide free
  • Suitable for: WB, ICC/IF, IP
  • Reacts with: Mouse, Human
  • Isotype: IgG

You may also be interested in

Product image
Anti-MCM4 (phospho S54) antibody (ab74014)
Product image
Anti-BST2/Tetherin antibody [EPR23597-266] (ab272169)
Product image
Anti-NEK8 antibody - N-terminal (ab153879)
Product image
Anti-TRAF1 antibody (ab203316)

Overview

  • Product name

    Anti-MCM7/PRL antibody - BSA and Azide free
    See all MCM7/PRL primary antibodies
  • Description

    Rabbit polyclonal to MCM7/PRL - BSA and Azide free
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IF, IPmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Cow
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Human MCM7/PRL aa 562-719 (C terminal).
    Sequence:

    YIAMCREKQPMVPESLADYITAAYVEMRREAWASKDATYTSARTLLAILR LSTALARLRMVDVVEKEDVNEAIRLMEMSKDSLLGDKGQTARTQRPADVI FATVRELVS GGRSVRFSEAEQRCVSRGFTPAQFQAALDEYEELNVWQVNASRTRITFV


    Database link: P33993
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • Human HeLa, SiHa, C33A, WI38 cell extracts; Mouse NIH 3T3 cell extract.
  • General notes

     This product was previously labelled as MCM7

     

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 6
    Constituents: 50% Glycerol (glycerin, glycerine), 50% PBS
  • Carrier free

    Yes
  • Concentration information loading...
  • Purity

    Protein A purified
  • Purification notes

    ab179904 is filter-sterilised.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

    • Epigenetics and Nuclear Signaling
    • DNA / RNA
    • DNA Synthesis
    • Other

Images

  • Western blot - Anti-MCM7/PRL antibody - BSA and Azide free (ab179904)
    Western blot - Anti-MCM7/PRL antibody - BSA and Azide free (ab179904)
    All lanes : Anti-MCM7/PRL antibody - BSA and Azide free (ab179904) at 1/1000 dilution

    Lane 1 : SiHa whole cell extract
    Lane 2 : C33A whole cell extract
    Lane 3 : WI38 whole cell extract

    Lysates/proteins at 100000 cells per lane.

    Predicted band size: 81 kDa

  • Western blot - Anti-MCM7/PRL antibody - BSA and Azide free (ab179904)
    Western blot - Anti-MCM7/PRL antibody - BSA and Azide free (ab179904)
    All lanes : Anti-MCM7/PRL antibody - BSA and Azide free (ab179904) at 1/2000 dilution

    Lane 1 : HeLa whole cell extract
    Lane 2 : HeLa whole cell extract treated with 100 nM adriamycin for 24 hours
    Lane 3 : NIH 3T3 whole cell extract

    Predicted band size: 81 kDa

  • Immunoprecipitation - Anti-MCM7/PRL antibody - BSA and Azide free (ab179904)
    Immunoprecipitation - Anti-MCM7/PRL antibody - BSA and Azide free (ab179904)

    Immunoprecipitation analysis on crude extracts of fibroblast cell line WI38 using ab179904. 

    Lane 1; Immunoprecipitation with pre-immune serum.

    Lane 2; Immnoprecipitation with ab179904 antiserum. 

    Cells were labeled with S35 methionine and MCM7/PRL was immunoprecipitated with ab179904 followed by SDS-PAGE and autoradiography.

  • Immunocytochemistry/ Immunofluorescence - Anti-MCM7/PRL antibody - BSA and Azide free (ab179904)
    Immunocytochemistry/ Immunofluorescence - Anti-MCM7/PRL antibody - BSA and Azide free (ab179904)

    Immunofluorecent staining and confocal microscopic analysis of formaldehyde-fixed G1 phase HeLa cell nucleus, labeling MCM7/PRL using ab179904 at 1/200 dilution, after treatment with protein cross-linking reagent, DSP and chromatin extraction.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Alternative products to Anti-MCM7/PRL antibody - BSA and Azide free (ab179904)

  •  
  • Product image

    Anti-MCM7/PRL antibody [EPR1973Y] (ab134194)

    Applications: Flow Cyt, WB

  •  
  • Product image

    Alexa Fluor® 488 Anti-MCM7/PRL antibody [EP1974Y] (ab199753)

    Applications: ICC/IF

  •  
  • Product image

    Alexa Fluor® 647 Anti-MCM7/PRL antibody [EP1974Y] (ab199818)

    Applications: ICC/IF

  •  
  • Product image

    Anti-MCM7/PRL antibody (ab140258)

    Applications: WB

  •  
  • Product image

    Anti-MCM7/PRL antibody [EP1974Y] (ab52489)

    Applications: Flow Cyt, ICC/IF, IHC-P, IP, WB

  •  
  • Product image

    Anti-MCM7/PRL antibody [EP1974Y] - BSA and Azide free (ab242382)

    Applications: Flow Cyt, ICC/IF, IHC-P, IP, WB

  •  
  • Product image

    Anti-MCM7/PRL antibody (ab51062)

    Applications: WB

Clear all

Recently viewed products

  •  
  • Product image

    Anti-Nesprin3 antibody [EPR15623-5] (ab186751)

Get resources and offers direct to your inbox Sign up
© 2021 Astana Biomed Group LLP. All rights reserved.