Anti-MCM7/PRL antibody - BSA and Azide free (ab179904)
Key features and details
- Rabbit polyclonal to MCM7/PRL - BSA and Azide free
- Suitable for: WB, ICC/IF, IP
- Reacts with: Mouse, Human
- Isotype: IgG
Overview
-
Product name
Anti-MCM7/PRL antibody - BSA and Azide free
See all MCM7/PRL primary antibodies -
Description
Rabbit polyclonal to MCM7/PRL - BSA and Azide free -
Host species
Rabbit -
Tested applications
Suitable for: WB, ICC/IF, IPmore details -
Species reactivity
Reacts with: Mouse, Human
Predicted to work with: Cow -
Immunogen
Recombinant fragment (His-tag) corresponding to Human MCM7/PRL aa 562-719 (C terminal).
Sequence:YIAMCREKQPMVPESLADYITAAYVEMRREAWASKDATYTSARTLLAILR LSTALARLRMVDVVEKEDVNEAIRLMEMSKDSLLGDKGQTARTQRPADVI FATVRELVS GGRSVRFSEAEQRCVSRGFTPAQFQAALDEYEELNVWQVNASRTRITFV
Database link: P33993 -
Positive control
- Human HeLa, SiHa, C33A, WI38 cell extracts; Mouse NIH 3T3 cell extract.
-
General notes
This product was previously labelled as MCM7
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 6
Constituents: 50% Glycerol (glycerin, glycerine), 50% PBS -
Carrier free
Yes -
Concentration information loading...
-
Purity
Protein A purified -
Purification notes
ab179904 is filter-sterilised. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Images
-
All lanes : Anti-MCM7/PRL antibody - BSA and Azide free (ab179904) at 1/1000 dilution
Lane 1 : SiHa whole cell extract
Lane 2 : C33A whole cell extract
Lane 3 : WI38 whole cell extract
Lysates/proteins at 100000 cells per lane.
Predicted band size: 81 kDa
-
All lanes : Anti-MCM7/PRL antibody - BSA and Azide free (ab179904) at 1/2000 dilution
Lane 1 : HeLa whole cell extract
Lane 2 : HeLa whole cell extract treated with 100 nM adriamycin for 24 hours
Lane 3 : NIH 3T3 whole cell extract
Predicted band size: 81 kDa
-
Immunoprecipitation analysis on crude extracts of fibroblast cell line WI38 using ab179904.
Lane 1; Immunoprecipitation with pre-immune serum.
Lane 2; Immnoprecipitation with ab179904 antiserum.
Cells were labeled with S35 methionine and MCM7/PRL was immunoprecipitated with ab179904 followed by SDS-PAGE and autoradiography.
-
Immunofluorecent staining and confocal microscopic analysis of formaldehyde-fixed G1 phase HeLa cell nucleus, labeling MCM7/PRL using ab179904 at 1/200 dilution, after treatment with protein cross-linking reagent, DSP and chromatin extraction.