Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category
Neuroscience Cell Adhesion Proteins Membrane Proteins

Anti-MAG/GMA antibody (ab89780)

Price and availability

381 945 ₸

Availability

Order now and get it on Tuesday March 02, 2021

Anti-MAG/GMA antibody (ab89780)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)

Key features and details

  • Mouse monoclonal to MAG/GMA
  • Suitable for: ICC, Flow Cyt, WB
  • Reacts with: Cat, Human, Recombinant fragment
  • Isotype: IgG1

You may also be interested in

Product image
Anti-HNT antibody (ab230351)
Recombinant Human Cathepsin B protein (ab151914)
Product image
Human Cathepsin D ELISA Kit (ab213470)
Product image
Anti-PCDHGB4 antibody - N-terminal (ab155417)

Overview

  • Product name

    Anti-MAG/GMA antibody
    See all MAG/GMA primary antibodies
  • Description

    Mouse monoclonal to MAG/GMA
  • Host species

    Mouse
  • Tested Applications & Species

    Application Species
    Flow Cyt
    Human
    ICC
    Human
    WB
    Human
    Recombinant fragment
    See all applications and species data
  • Immunogen

    Recombinant fragment corresponding to Human MAG/GMA aa 119-208.
    Sequence:

    GDLGGYNQYTFSEHSVLDIVNTPNIVVPPEVVAGTEVEVSCMVPDNCPEL RPELSWLGHEGLGEPAVLGRLREDEGTWVQVSLLHFVPTR


    Database link: NP_002352
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • Partial tagged recombinant Human MAG/GMA protein (Immunogen), Jurkat whole cell lysate (ab7899). This antibody gave a positive result in IF in the following Formaldehyde fixed cell line: SKNSH.
  • General notes

    This product was previously labelled as MAG

    This product was changed from ascites to tissue culture supernatant on 4th April 2019. Please note that the dilutions may need to be adjusted accordingly. If you have any questions, please do not hesitate to contact our scientific support team.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer

    pH: 7.40
    Constituent: PBS
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Monoclonal
  • Isotype

    IgG1
  • Light chain type

    kappa
  • Research areas

    • Neuroscience
    • Cell Adhesion Proteins
    • Membrane Proteins
    • Neuroscience
    • Neurology process
    • Neurogenesis
    • Neuroscience
    • Neurology process
    • Neuroregeneration
    • Neuroregeneration

Images

  • Western blot - Anti-MAG/GMA antibody (ab89780)
    Western blot - Anti-MAG/GMA antibody (ab89780)
    Anti-MAG/GMA antibody (ab89780) at 5 µg/ml + Jurkat cell lysate at 50 µg

    Predicted band size: 63 kDa
    Observed band size: 53 kDa
    why is the actual band size different from the predicted?



    This image was generated using the ascites version of the product.

  • Flow Cytometry - Anti-MAG/GMA antibody (ab89780)
    Flow Cytometry - Anti-MAG/GMA antibody (ab89780)

    Overlay histogram showing SH-SY5Y cells stained with ab89780 (red line). The cells were fixed with 4% paraformaldehyde (10 min) and incubated in 1x PBS / 10% normal goat serum / 0.3M glycine to block non-specific protein-protein interactions. The cells were then incubated with the antibody (ab89780, 1µg/1x106 cells) for 30 min at 22ºC. The secondary antibody used was DyLight® 488 goat anti-mouse IgG (H+L) (ab96879) at 1/500 dilution for 30 min at 22ºC. Isotype control antibody (black line) was mouse IgG1 [ICIGG1] (ab91353, 2µg/1x106 cells) used under the same conditions. Acquisition of >5,000 events was performed. This antibody gave a positive signal in SH-SY5Y cells fixed with 80% methanol (5 min) used under the same conditions.
    Please note that Abcam do not have any data for use of this antibody on non-fixed cells. We welcome any customer feedback.

    This image was generated using the ascites version of the product.

  • Immunocytochemistry - Anti-MAG/GMA antibody (ab89780)
    Immunocytochemistry - Anti-MAG/GMA antibody (ab89780)

    ab89780 stained SKNSH cells. The cells were 4% formaldehyde fixed (10 min) and then incubated in 1%BSA / 10% normal goat serum / 0.3M glycine in 0.1% PBS-Tween for 1h to permeabilise the cells and block non-specific protein-protein interactions. The cells were then incubated with the antibody ab89780 at 10µg/ml overnight at +4°C. The secondary antibody (green) was DyLight® 488 goat anti- mouse (ab96879) IgG (H+L) used at a 1/1000 dilution for 1h. Alexa Fluor® 594 WGA was used to label plasma membranes (red) at a 1/200 dilution for 1h. DAPI was used to stain the cell nuclei (blue) at a concentration of 1.43µM.

    This image was generated using the ascites version of the product.

  • Western blot - Anti-MAG/GMA antibody (ab89780)
    Western blot - Anti-MAG/GMA antibody (ab89780)
    Anti-MAG/GMA antibody (ab89780) at 5 µg/ml + Partial tagged recombinant Human MAG/GMA protein at 0.2 µg

    Predicted band size: 63 kDa
    Observed band size: 36 kDa why is the actual band size different from the predicted?



    Western blot against tagged recombinant protein immunogen. Predicted band size of immunogen is 36 kDa.

    This image was generated using the ascites version of the product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Alternative products to Anti-MAG/GMA antibody (ab89780)

  •  
  • Product image

    Anti-MAG/GMA antibody (ab203060)

    Applications: WB

  •  
  • Product image

    Anti-MAG/GMA antibody [EP971Y] (ab46803)

    Applications: WB

  •  
  • Product image

    Anti-MAG/GMA antibody (ab203058)

    Applications: IHC-P

Clear all

Recently viewed products

  •  
  • Product image

    Anti-INPP1 antibody (ab97912)

  •  
  • Product image

    Canine Transferrin ELISA Kit (ab157704)

Get resources and offers direct to your inbox Sign up
© 2021 Astana Biomed Group LLP. All rights reserved.