Anti-MAG/GMA antibody (ab89780)
Key features and details
- Mouse monoclonal to MAG/GMA
- Suitable for: ICC, Flow Cyt, WB
- Reacts with: Cat, Human, Recombinant fragment
- Isotype: IgG1
Overview
-
Product name
Anti-MAG/GMA antibody
See all MAG/GMA primary antibodies -
Description
Mouse monoclonal to MAG/GMA -
Host species
Mouse -
Tested Applications & Species
See all applications and species dataApplication Species Flow Cyt HumanICC HumanWB HumanRecombinant fragment -
Immunogen
Recombinant fragment corresponding to Human MAG/GMA aa 119-208.
Sequence:GDLGGYNQYTFSEHSVLDIVNTPNIVVPPEVVAGTEVEVSCMVPDNCPEL RPELSWLGHEGLGEPAVLGRLREDEGTWVQVSLLHFVPTR
Database link: NP_002352 -
Positive control
- Partial tagged recombinant Human MAG/GMA protein (Immunogen), Jurkat whole cell lysate (ab7899). This antibody gave a positive result in IF in the following Formaldehyde fixed cell line: SKNSH.
-
General notes
This product was previously labelled as MAG
This product was changed from ascites to tissue culture supernatant on 4th April 2019. Please note that the dilutions may need to be adjusted accordingly. If you have any questions, please do not hesitate to contact our scientific support team.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. -
Storage buffer
pH: 7.40
Constituent: PBS -
Concentration information loading... -
Purity
Protein A purified -
Clonality
Monoclonal -
Isotype
IgG1 -
Light chain type
kappa -
Research areas
Images
-
Anti-MAG/GMA antibody (ab89780) at 5 µg/ml + Jurkat cell lysate at 50 µg
Predicted band size: 63 kDa
Observed band size: 53 kDa why is the actual band size different from the predicted?This image was generated using the ascites version of the product.
-
Overlay histogram showing SH-SY5Y cells stained with ab89780 (red line). The cells were fixed with 4% paraformaldehyde (10 min) and incubated in 1x PBS / 10% normal goat serum / 0.3M glycine to block non-specific protein-protein interactions. The cells were then incubated with the antibody (ab89780, 1µg/1x106 cells) for 30 min at 22ºC. The secondary antibody used was DyLight® 488 goat anti-mouse IgG (H+L) (ab96879) at 1/500 dilution for 30 min at 22ºC. Isotype control antibody (black line) was mouse IgG1 [ICIGG1] (ab91353, 2µg/1x106 cells) used under the same conditions. Acquisition of >5,000 events was performed. This antibody gave a positive signal in SH-SY5Y cells fixed with 80% methanol (5 min) used under the same conditions.
Please note that Abcam do not have any data for use of this antibody on non-fixed cells. We welcome any customer feedback.This image was generated using the ascites version of the product.
-
ab89780 stained SKNSH cells. The cells were 4% formaldehyde fixed (10 min) and then incubated in 1%BSA / 10% normal goat serum / 0.3M glycine in 0.1% PBS-Tween for 1h to permeabilise the cells and block non-specific protein-protein interactions. The cells were then incubated with the antibody ab89780 at 10µg/ml overnight at +4°C. The secondary antibody (green) was DyLight® 488 goat anti- mouse (ab96879) IgG (H+L) used at a 1/1000 dilution for 1h. Alexa Fluor® 594 WGA was used to label plasma membranes (red) at a 1/200 dilution for 1h. DAPI was used to stain the cell nuclei (blue) at a concentration of 1.43µM.
This image was generated using the ascites version of the product.
-
Anti-MAG/GMA antibody (ab89780) at 5 µg/ml + Partial tagged recombinant Human MAG/GMA protein at 0.2 µg
Predicted band size: 63 kDa
Observed band size: 36 kDa why is the actual band size different from the predicted?Western blot against tagged recombinant protein immunogen. Predicted band size of immunogen is 36 kDa.
This image was generated using the ascites version of the product.

