Anti-MAGE3 antibody [OTI1H1] (ab140678)
Key features and details
- Mouse monoclonal [OTI1H1] to MAGE3
- Suitable for: WB, IHC-P
- Reacts with: Human
- Isotype: IgG1
Overview
-
Product name
Anti-MAGE3 antibody [OTI1H1]
See all MAGE3 primary antibodies -
Description
Mouse monoclonal [OTI1H1] to MAGE3 -
Host species
Mouse -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant full length protein corresponding to Human MAGE3 aa 1-314.
Sequence:MPLEQRSQHCKPEEGLEARGEALGLVGAQAPATEEQEAASSSSTLVEVTL GEVPAAESPDPPQSPQGASSLPTTMNYPLWSQSYEDSSNQEEEGPSTFPD LESEFQAALSRKVAELVHFLLLKYRAREPVTKAEMLGSVVGNWQYFFPVI FSKASSSLQLVFGIELMEVDPIGHLYIFATCLGLSYDGLLGDNQIMPKAG LLIIVLAIIAREGDCAPEEKIWEELSVLEVFEGREDSILGDPKKLLTQHF VQENYLEYRQVPGSDPACYEFLWGPRALVETSYVKVLHHMVKISGGPHIS YPPLHEWVLREGEE
Database link: NP_005353 -
Positive control
- HEK293T cell lysate transfected with pCMV6-ENTRY MAGE3 cDNA; Human kidney and colon adenocarcinoma tissues
-
General notes
The clone number has been updated from 1H1 to OTI1H1, both clone numbers name the same clone.
Dilute in PBS (pH7.3) before use.
This product was changed from ascites to tissue culture supernatant on 10th September 2018. Please note that the dilutions may need to be adjusted accordingly. If you have any questions, please do not hesitate to contact our scientific support team.
This product was previously labelled as MAGEA3
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles. -
Storage buffer
pH: 7.30
Preservative: 0.02% Sodium azide
Constituents: 48% PBS, 50% Glycerol, 1% BSA -
Concentration information loading...
-
Purity
Protein G purified -
Purification notes
ab140678 is purified from TCS by affinity chromatography. -
Clonality
Monoclonal -
Clone number
OTI1H1 -
Isotype
IgG1 -
Research areas
Images
-
All lanes : Anti-MAGE3 antibody [OTI1H1] (ab140678) at 1/2000 dilution
Lane 1 : HEK293T cell lysate transfected with pCMV6-ENTRY control
Lane 2 : HEK293T cell lysate transfected with pCMV6-ENTRY MAGE3 cDNA
Lysates/proteins at 5 µg per lane.
Predicted band size: 35 kDa
HEK293T cell lysates were generated from transient transfection of the cDNA clone (RC210002) -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-MAGE3 antibody [OTI1H1] (ab140678)
Immunohistochemical analysis of paraffin-embedded Human colon adenocarcinoma tissue labelling MAGE3 with ab140678 at 1/150 dilution.