Anti-LRRFIP1 antibody (ab176587)
Key features and details
- Rabbit polyclonal to LRRFIP1
- Suitable for: WB, IP
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-LRRFIP1 antibody
See all LRRFIP1 primary antibodies -
Description
Rabbit polyclonal to LRRFIP1 -
Host species
Rabbit -
Tested Applications & Species
See all applications and species dataApplication Species IP HumanWB Human -
Immunogen
Synthetic peptide within Human LRRFIP1 aa 758-808 (C terminal). The exact sequence is proprietary. (NP_001131024.1).
Sequence:QTVRKALDSNSLENDDLSAPGREPGHFNPESREDTRGGNEKGKSKEDCTM S
Database link: Q32MZ4 -
Positive control
- HeLa and 293T whole cell lysates.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 6.8
Preservative: 0.09% Sodium azide
Constituents: 99% Tris buffered saline, 0.1% BSA -
Concentration information loading... -
Purity
Immunogen affinity purified -
Purification notes
ab176587 was affinity purified using an epitope specific to LRRFIP1 immobilized on solid support. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Images
-
Detection of LRRFIP1 in Immunoprecipitates of HeLa whole cell lysate (1 mg for IP, 20% of IP loaded) using ab176587 at 6 µg/mg lysate for IP (Lane 1). For WB detection ab176587 was used at 0.4 µg/ml. Lane 2 represents control IgG IP.
Detection: Chemiluminescence with an exposure time of 1 second.
-
All lanes : Anti-LRRFIP1 antibody (ab176587) at 0.04 µg/ml
Lane 1 : HeLa whole cell lysate at 50 µg
Lane 2 : HeLa whole cell lysate at 15 µg
Lane 3 : HeLa whole cell lysate at 5 µg
Lane 4 : 293T whole cell lysate at 50 µg
Developed using the ECL technique.
Predicted band size: 89 kDa
Exposure time: 30 seconds

