Anti-IL36 gamma/IL-1F9 antibody [OTI2F4] (ab156783)
Key features and details
- Mouse monoclonal [OTI2F4] to IL36 gamma/IL-1F9
- Suitable for: WB, IHC-P, ICC/IF
- Reacts with: Human
- Isotype: IgG1
Overview
-
Product name
Anti-IL36 gamma/IL-1F9 antibody [OTI2F4]
See all IL36 gamma/IL-1F9 primary antibodies -
Description
Mouse monoclonal [OTI2F4] to IL36 gamma/IL-1F9 -
Host species
Mouse -
Tested Applications & Species
See all applications and species dataApplication Species ICC/IF HumanIHC-P HumanWB Human -
Immunogen
Recombinant full length protein corresponding to Human IL36 gamma/IL-1F9 aa 1-169.
Sequence:MRGTPGDADGGGRAVYQSMCKPITGTINDLNQQVWTLQGQNLVAVPRSDS VTPVTVAVITCKYPEALEQGRGDPIYLGIQNPEMCLYCEKVGEQPTLQLK EQKIMDLYGQPEPVKPFLFYRAKTGRTSTLESVAFPDWFIASSKRDQPII LTSELGKSYNTAFELNIND
Database link: NP_062564 -
Positive control
- HEK293T cells transfected with pCMV6-ENTRY IL-36 gamma/IL-1F9 cDNA; Human colon adenocarcinoma and pancreas tissues; HeLa cells
-
General notes
Dilute in PBS (pH7.3) before use.
The clone number has been updated from 2F4 to OTI2F4, both clone numbers name the same clone.
This product was changed from ascites to tissue culture supernatant on 29th May 2018. Please note that the dilutions may need to be adjusted accordingly. If you have any questions, please do not hesitate to contact our scientific support team.
Previously labelled as IL36 gamma.
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing the problem with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation.
One factor contributing to the crisis is the use of antibodies that are not suitable. This can lead to misleading results and the use of incorrect data informing project assumptions and direction. To help address this challenge, we have introduced an application and species grid on our primary antibody datasheets to make it easy to simplify identification of the right antibody for your needs.
Learn more here.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles. -
Storage buffer
pH: 7.30
Preservative: 0.02% Sodium azide
Constituents: 48% PBS, 1% BSA, 50% Glycerol -
Concentration information loading...
-
Purity
Protein G purified -
Purification notes
ab156783 is purified from TCS by affinity chromatography -
Clonality
Monoclonal -
Clone number
OTI2F4 -
Isotype
IgG1 -
Research areas
Images
-
All lanes : Anti-IL36 gamma/IL-1F9 antibody [OTI2F4] (ab156783) at 1/4000 dilution
Lane 1 : HEK293T cells transfected with pCMV6-ENTRY control
Lane 2 : HEK293T cells transfected with pCMV6-ENTRY IL36 gamma/IL-1F9 cDNA
Lysates/proteins at 5 µg per lane.
Predicted band size: 19 kDa
HEK293T cell lysates were generated from transient transfection of the cDNA clone (RC213525) -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-IL36 gamma/IL-1F9 antibody [OTI2F4] (ab156783)
Immunohistochemical analysis of paraffin-embedded Human colon adenocarcinoma tissue labeling IL36 gamma/IL-1F9 with ab156783 at 1/150 dilution.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-IL36 gamma/IL-1F9 antibody [OTI2F4] (ab156783)
Immunohistochemical analysis of paraffin-embedded Human pancreas tissue labeling IL36 gamma/IL-1F9 with ab156783 at 1/150 dilution
-
Immunofluorescent analysis of HeLa cells labeling IL36 gamma/IL-1F9 using ab156783 at 1/100 dilution.