Anti-HSD17B13 antibody (ab122036)
Key features and details
- Rabbit polyclonal to HSD17B13
- Suitable for: ICC/IF, IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-HSD17B13 antibody
See all HSD17B13 primary antibodies -
Description
Rabbit polyclonal to HSD17B13 -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IF, IHC-Pmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human HSD17B13 aa 119-247.
Sequence:NNAGTVYPADLLSTKDEEITKTFEVNILGHFWITKALLPSMMERNHGHIV TVASVCGHEGIPYLIPYCSSKFAAVGFHRGLTSELQALGKTGIKTSCLCP VFVNTGFTKNPSTRLWPVLETDEVVRSLI
-
Positive control
- IHC: Human liver and skin tissue sections; ICC/IF: Human cell line U-251MG.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 59% PBS, 40% Glycerol -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-HSD17B13 antibody (ab122036)
Immunohistochemical analysis of human liver tissue labeling HSD17B13 with ab122036 at 1/200 dilution. Moderate to strong granular cytoplasmic positivity in hepatocytes is shown.
-
Immunofluorescent staining of Human cell line U-251MG shows positivity in golgi apparatus and vesicles. Recommended concentration of ab122036 1-4 µg/ml. Cells treated with PFA/Triton X-100.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-HSD17B13 antibody (ab122036)
Immunohistochemical analysis of human skin tissue labeling HSD17B13 with ab122036 at 1/200 dilution. Moderate granular cytoplasmic positivity in basal epidermal cells is shown.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-HSD17B13 antibody (ab122036)
Immunohistochemical analysis of human tonsil tissue labeling HSD17B13 with ab122036 at 1/200 dilution. As expected, no positivity in lymphoid cells is shown.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-HSD17B13 antibody (ab122036)
Immunohistochemical analysis of human placenta tissue labeling HSD17B13 with ab122036 at 1/500 dilution. As expected, no positivity in trophoblastic cells is shown.