Anti-HRP antibody (ab181708)
Key features and details
- Mouse polyclonal to HRP
- Suitable for: WB
- Reacts with: Horseradish
- Isotype: IgG
Overview
-
Product name
Anti-HRP antibody
See all HRP primary antibodies -
Description
Mouse polyclonal to HRP -
Host species
Mouse -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Horseradish -
Immunogen
Full length native protein (purified) corresponding to HRP aa 31-338.
Sequence:QLTPTFYDNSCPNVSNIVRDTIVNELRSDPRIAASILRLHFHDCFVNGCD ASILLDNTTSFRTEKDAFGNANSARGFPVIDRMKAAVESACPRTVSCADL LTIAAQQSVTLAGGPSWRVPLGRRDSLQAFLDLANANLPAPFFTLPQLKD SFRNVGLNRSSDLVALSGGHTFGKNQCRFIMDRLYNFSNTGLPDPTLNTT YLQTLRGLCPLNGNLSALVDFDLRTPTIFDNKYYVNLEEQKGLIQSDQEL FSSPNATDTIPLVRSFANSTQTFFNAFVEAMDRMGNITPLTGTQGQIRLN CRVVNSNS
Database link: P00433 -
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Constituents: 0.88% Sodium chloride, 0.27% Potassium phosphate
Does not contain preservative or stabilizer -
Concentration information loading...
-
Purity
IgG fraction -
Purification notes
ab181708 is an IgG fraction antibody purified from monospecific antiserum by a multi-step process which includes delipidation, salt fractionation and ion exchange chromatography followed by extensive dialysis against the stated buffer stated. Assay by immunoelectrophoresis resulted in a single precipitin arc against anti-Mouse Serum as well as purified and partially purified Peroxidase [Horseradish]. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Images
-
Anti-HRP antibody (ab181708) at 1/1000 dilution (overnight at 4°C) + Peroxidase (Horseradish) at 0.1 µg
Secondary
Fluorescein conjugated mouse secondary antibody for 30 minutes at room temperature at 1/40000 dilution
Predicted band size: 39 kDa
Observed band size: 44 kDa why is the actual band size different from the predicted?Block: Blocking Buffer for Fluorescent Western Blotting for 30 minutes at room temperature.