Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category

Anti-ADFP antibody [2C5A3] (ab181463)

Price and availability

274 732 ₸

Availability

Order now and get it on Wednesday March 03, 2021

Anti-ADFP antibody [2C5A3] (ab181463)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)

Key features and details

  • Mouse monoclonal [2C5A3] to ADFP
  • Suitable for: IHC-P, WB
  • Reacts with: Human, Recombinant fragment
  • Isotype: IgG1

You may also be interested in

Product image
Anti-GALNS/Chondroitinase antibody (ab231647)
Anti-GCDH/GCD antibody (ab75324)
Product image
Anti-Mesothelin antibody [PPI-2e(IHC)] (ab92347)
Product image
Anti-IRS1 (phospho S307) antibody (ab5599)

Overview

  • Product name

    Anti-ADFP antibody [2C5A3]
    See all ADFP primary antibodies
  • Description

    Mouse monoclonal [2C5A3] to ADFP
  • Host species

    Mouse
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human, Recombinant fragment
  • Immunogen

    Recombinant fragment corresponding to Human ADFP aa 286-437. (Expressed in E.coli).
    Sequence:

    VEWKRSIGYDDTDESHCAEHIESRTLAIARNLTQQLQTTCHTLLSNIQGV PQNIQDQAKHMGVMAGDIYSVFRNAASFKEVSDSLLTSSKGQLQKMKESL DDVMDYLVNNTPLNWLVGPFYPQLTESQNAQDQGAEMDKSSQETQRSEHK TH


    Database link: Q99541
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • ADFP recombinant protein; ADFP (Amino acids: 286-437)-hIgGFc transfected HEK293 cell lysate; Human liver cancer and esophageal cancer tissues.
  • General notes

    This product was changed from ascites to supernatant. Lot no’s high than GR154667-17 are from Tissue Culture Supernatant

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.05% Sodium azide
    Constituent: 99% PBS

    Contains 0.5% protein stabilizer.
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purified from tissue culture supernatant.
  • Clonality

    Monoclonal
  • Clone number

    2C5A3
  • Isotype

    IgG1
  • Research areas

    • Cardiovascular
    • Hypoxia
    • Hypoxia-Regulated
    • Cardiovascular
    • Lipids / Lipoproteins
    • Adipose Related
    • Lipid Droplet Protein
    • Signal Transduction
    • Metabolism
    • Lipid metabolism
    • Cardiovascular
    • Atherosclerosis
    • Lipid transport
    • Cancer
    • Cancer Metabolism
    • Metabolic signaling pathway
    • Metabolism of lipids and lipoproteins
    • Metabolism
    • Pathways and Processes
    • Metabolic signaling pathways
    • Lipid and lipoprotein metabolism
    • Lipid metabolism
    • Metabolism
    • Pathways and Processes
    • Metabolism processes
    • Hypoxia
    • Metabolism
    • Types of disease
    • Heart disease

Images

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-ADFP antibody [2C5A3] (ab181463)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-ADFP antibody [2C5A3] (ab181463)

    Immunohistochemical analysis of paraffin-embedded Human esophageal cancer tissue labeling ADFP with ab181463 at 1/200 dilution.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-ADFP antibody [2C5A3] (ab181463)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-ADFP antibody [2C5A3] (ab181463)

    Immunohistochemical analysis of paraffin-embedded Human liver cancer tissue labeling ADFP with ab181463 at 1/200 dilution.

  • Western blot - Anti-ADFP antibody [2C5A3] (ab181463)
    Western blot - Anti-ADFP antibody [2C5A3] (ab181463)
    All lanes : Anti-ADFP antibody [2C5A3] (ab181463) at 1/500 dilution

    Lane 1 : HEK293 cell lysate.
    Lane 2 : ADFP (Amino acids : 286-437)-hIgGFc transfected HEK293 cell lysate.

    Predicted band size: 48 kDa

  • Western blot - Anti-ADFP antibody [2C5A3] (ab181463)
    Western blot - Anti-ADFP antibody [2C5A3] (ab181463)
    Anti-ADFP antibody [2C5A3] (ab181463) at 1/500 dilution + ADFP recombinant protein.

    Predicted band size: 48 kDa



    Expected MWt is 42.6 kDa.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Alternative products to Anti-ADFP antibody [2C5A3] (ab181463)

  •  
  • Product image

    Anti-ADFP antibody [EPR3713] (ab108323)

    Applications: Flow Cyt, ICC/IF, WB

  •  
  • Product image

    Alexa Fluor® 488 Anti-ADFP antibody [EPR3713] (ab201535)

    Applications: Flow Cyt, ICC/IF

  •  
  • Product image

    Anti-ADFP antibody [EPR3713] - BSA and Azide free (ab232483)

    Applications: Flow Cyt, ICC/IF, WB

  •  
  • Product image

    Alexa Fluor® 647 Anti-ADFP antibody [EPR3713] (ab201351)

    Applications: ICC/IF

  •  
  • Product image

    HRP Anti-ADFP antibody [EPR3713] (ab201721)

    Applications: WB

Clear all

Recently viewed products

  •  
  • Product image

    Anti-UPB1 antibody (ab231329)

  •  
  • Product image

    Anti-CD40 antibody [3/23] (ab22469)

  •  
  • Product image

    Anti-ZNF18 antibody (ab243379)

  •  
  • Product image

    Anti-TNIK antibody (ab224252)

  •  
  • Product image

    Anti-PCDH18 antibody (ab224404)

  •  
  • Product image

    Anti-TRPS1 antibody (ab221118)

Get resources and offers direct to your inbox Sign up
© 2021 Astana Biomed Group LLP. All rights reserved.