Anti-ADFP antibody [2C5A3] (ab181463)
Key features and details
- Mouse monoclonal [2C5A3] to ADFP
- Suitable for: IHC-P, WB
- Reacts with: Human, Recombinant fragment
- Isotype: IgG1
Overview
-
Product name
Anti-ADFP antibody [2C5A3]
See all ADFP primary antibodies -
Description
Mouse monoclonal [2C5A3] to ADFP -
Host species
Mouse -
Tested applications
Suitable for: IHC-P, WBmore details -
Species reactivity
Reacts with: Human, Recombinant fragment -
Immunogen
Recombinant fragment corresponding to Human ADFP aa 286-437. (Expressed in E.coli).
Sequence:VEWKRSIGYDDTDESHCAEHIESRTLAIARNLTQQLQTTCHTLLSNIQGV PQNIQDQAKHMGVMAGDIYSVFRNAASFKEVSDSLLTSSKGQLQKMKESL DDVMDYLVNNTPLNWLVGPFYPQLTESQNAQDQGAEMDKSSQETQRSEHK TH
Database link: Q99541 -
Positive control
- ADFP recombinant protein; ADFP (Amino acids: 286-437)-hIgGFc transfected HEK293 cell lysate; Human liver cancer and esophageal cancer tissues.
-
General notes
This product was changed from ascites to supernatant. Lot no’s high than GR154667-17 are from Tissue Culture Supernatant
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.05% Sodium azide
Constituent: 99% PBS
Contains 0.5% protein stabilizer. -
Concentration information loading...
-
Purity
Protein G purified -
Purification notes
Purified from tissue culture supernatant. -
Clonality
Monoclonal -
Clone number
2C5A3 -
Isotype
IgG1 -
Research areas
Images
-
Immunohistochemical analysis of paraffin-embedded Human esophageal cancer tissue labeling ADFP with ab181463 at 1/200 dilution.
-
Immunohistochemical analysis of paraffin-embedded Human liver cancer tissue labeling ADFP with ab181463 at 1/200 dilution.
-
All lanes : Anti-ADFP antibody [2C5A3] (ab181463) at 1/500 dilution
Lane 1 : HEK293 cell lysate.
Lane 2 : ADFP (Amino acids : 286-437)-hIgGFc transfected HEK293 cell lysate.
Predicted band size: 48 kDa
-
Anti-ADFP antibody [2C5A3] (ab181463) at 1/500 dilution + ADFP recombinant protein.
Predicted band size: 48 kDaExpected MWt is 42.6 kDa.