Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category

Anti-Histone H3 antibody (ab180727)

Price and availability

278 083 ₸

Availability

Order now and get it on Wednesday March 03, 2021

Anti-Histone H3 antibody (ab180727)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)

Key features and details

  • Rabbit polyclonal to Histone H3
  • Suitable for: WB
  • Reacts with: Mouse, Rat, Human
  • Isotype: IgG

You may also be interested in

Product image
Mouse Chemerin ELISA Kit (ab204520)
Product image
Anti-Nuclear Matrix Protein p84 antibody [EPR5662(2)] (ab131268)
Product image
Anti-Calnexin antibody [EPR3633(2)] - BSA and Azide free (ab225542)
Product image
Anti-LDB3 antibody [EPR10126] (ab171936)

Overview

  • Product name

    Anti-Histone H3 antibody
    See all Histone H3 primary antibodies
  • Description

    Rabbit polyclonal to Histone H3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
    Predicted to work with: Chicken, Cow, Xenopus laevis, Drosophila melanogaster, Xenopus tropicalis
  • Immunogen

    Recombinant full length protein corresponding to Human Histone H3 aa 1-136.
    Sequence:

    MARTKQTARKSTGGKAPRKQLATKVARKSAPATGGVKKPHRYRPGTVALR EIRRYQKSTELLIRKLPFQRLMREIAQDFKTDLRFQSSAVMALQEACESY LVGLFEDTNLCVIHAKRVTIMPKDIQLARRIRGERA


    Database link: Q16695
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • WB: HeLa, NIH3T3, Jurkat, 293T and A431 cell lysates and mouse and rat testis tissue lysate.
  • General notes

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.30
    Preservative: 0.02% Sodium azide
    Constituents: 49% PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG

Images

  • Western blot - Anti-Histone H3 antibody (ab180727)
    Western blot - Anti-Histone H3 antibody (ab180727)
    All lanes : Anti-Histone H3 antibody (ab180727)

    Lane 1 : HeLa cell lysate
    Lane 2 : NIH3T3 cell lysate
    Lane 3 : Jurkat cell lysate
    Lane 4 : 293T cell lysate
    Lane 5 : A431 cell lysate
    Lane 6 : Mouse testis tissue lysate
    Lane 7 : Rat testis tissue lysate

    Predicted band size: 16 kDa

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Alternative products to Anti-Histone H3 antibody (ab180727)

  •  
  • Product image

    Anti-Histone H3 (tri methyl K9) antibody [EPR16601] - ChIP Grade (ab176916)

    Applications: ChIP, Dot, ICC/IF, IHC-P, PepArr, WB

  •  
  • Product image

    Alexa Fluor® 647 Anti-Histone H3 (acetyl K14) antibody [EP964Y] (ab277919)

    Applications: ICC

  •  
  • Product image

    Anti-Histone H3 (tri methyl K27) antibody [EPR18607] - ChIP Grade (ab192985)

    Applications: ChIP, ChIP-seq, ELISA, ICC/IF, IHC-P, PepArr, WB

  •  
  • Product image

    Anti-Histone H3 antibody [EPR16987] - ChIP Grade (ab176842)

    Applications: ChIP, Flow Cyt, ICC/IF, IHC-P, PepArr, WB

  •  
  • Product image

    Alexa Fluor® 488 Anti-Histone H3 (acetyl K14) antibody [EP964Y] (ab277918)

    Applications: ICC

  •  
  • Product image

    Anti-Histone H3 (acetyl K14) antibody [EP964Y] - ChIP Grade (ab52946)

    Applications: ChIP, ICC/IF, IHC-P, WB

  •  
  • Product image

    Anti-Histone H3 (di methyl K4) antibody [Y47] - ChIP Grade (ab32356)

    Applications: ChIP, ChIP-seq, Flow Cyt, ICC/IF, IHC-P, IP, WB

  •  
  • Product image

    Anti-Histone H3 (citrulline R2) antibody [EPR17703] (ab176843)

    Applications: PepArr, WB

Clear all

Recently viewed products

  •  
  • Product image

    Anti-CD44 antibody [BLR038F] (ab243894)

  •  
  • Product image

    Anti-Phosphotyrosine antibody [RM111] (ab190824)

  •  
  • Product image

    Anti-IGJ antibody [SP105] (ab105229)

  •  
  • Product image

    Anti-IKKi/IKKe antibody (ab7891)

  •  
  • Product image

    Anti-FNTB antibody (ab236649)

  •  
  • Anti-FITC antibody [9] (ab116639)

Get resources and offers direct to your inbox Sign up
© 2021 Astana Biomed Group LLP. All rights reserved.