Anti-GLEPP1/PTPRO antibody (ab150834)
Key features and details
- Rabbit polyclonal to GLEPP1/PTPRO
- Suitable for: IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-GLEPP1/PTPRO antibody
See all GLEPP1/PTPRO primary antibodies -
Description
Rabbit polyclonal to GLEPP1/PTPRO -
Host species
Rabbit -
Tested Applications & Species
See all applications and species dataApplication Species IHC-P Human -
Immunogen
Recombinant fragment corresponding to Human GLEPP1/PTPRO aa 151-284.
Sequence:TRVNISYWEGKDFRTMLYKDFFKGKTVFNHWLPGMCYSNITFQLVSEATF NKSTLVEYSGVSHEPKQHRTAPYPPQNISVRIVNLNKNNWEEQSGNFPEE SFMRSQDTIGKEKLFHFTEETPEIPSGNISSGWP
Database link: Q16827 -
Positive control
- IHC-P: Human kidney tissue.
-
General notes
Store product undiluted. The antibody solution should be gently mixed before use.This product was previously labelled as GLEPP1
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 59% PBS, 40% Glycerol (glycerin, glycerine) -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-GLEPP1/PTPRO antibody (ab150834)Immunohistochemical analysis of paraffin-embedded human kidney tissue labelling GLEPP1/PTPRO in the membrane of cells in glomeruli with ab150834 at a 1/500 dilution.
Performed heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-GLEPP1/PTPRO antibody (ab150834)
Immunohistochemical analysis of paraffin-embedded human pancreas tissue labelling GLEPP1/PTPRO with ab150834 at a 1/500 dilution. No positivity as expected.
Performed heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-GLEPP1/PTPRO antibody (ab150834)
Immunohistochemical analysis of paraffin-embedded human liver tissue labelling GLEPP1/PTPRO with ab150834 at a 1/500 dilution. No positivity as expected.
Performed heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-GLEPP1/PTPRO antibody (ab150834)Immunohistochemical analysis of paraffin-embedded human cerebral cortex tissue labelling GLEPP1/PTPRO with ab150834 at a 1/500 dilution. No positivity as expected.
Performed heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

