Anti-GGT1/GGT antibody (ab55138)
Key features and details
- Mouse monoclonal to GGT1/GGT
- Suitable for: WB, IHC-P, ICC/IF, Flow Cyt
- Reacts with: Mouse, Human
- Isotype: IgG2a
Overview
-
Product name
Anti-GGT1/GGT antibody
See all GGT1/GGT primary antibodies -
Description
Mouse monoclonal to GGT1/GGT -
Host species
Mouse -
Tested Applications & Species
See all applications and species dataApplication Species Flow Cyt HumanICC/IF HumanIHC-P HumanWB Mouse -
Immunogen
Recombinant fragment corresponding to Human GGT1/GGT aa 381-470.
Sequence:TAHLSVVAEDGSAVSATSTINLYFGSKVRSPVSGILFNNEMDDFSSPSIT NEFGVPPSPANFIQPGKQPLSSMCPTIMVGQDGQVRMVVG
Database link: P19440 -
General notes
This product was previously labelled as GGT1
This product was changed from ascites to tissue culture supernatant on 20th Jan 2020. Lot numbers higher than GR3280625 are from tissue culture supernatant. Please note that the dilutions may need to be adjusted accordingly. If you have any questions, please do not hesitate to contact our scientific support team.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. -
Storage buffer
pH: 7.40
Constituent: PBS -
Concentration information loading... -
Purity
Tissue culture supernatant -
Clonality
Monoclonal -
Isotype
IgG2a -
Light chain type
kappa -
Research areas
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-GGT1/GGT antibody (ab55138)GGT1/GGT antibody (ab55138) used in immunohistochemistry at 3ug/ml on formalin fixed and paraffin embedded human testis.
This image was generated using the ascites version of the product.
-
GGT1/GGT antibody (ab55138) at 1ug/lane + NIH/3T3 cell lysate at 25ug/lane.
This image was generated using the ascites version of the product.
-
ICC/IF image of ab55138 stained HepG2 cells. The cells were 4% formaldehyde fixed (10 min) and then incubated in 1%BSA / 10% normal goat serum / 0.3M glycine in 0.1% PBS-Tween for 1h to permeabilise the cells and block non-specific protein-protein interactions. The cells were then incubated with the antibody (ab55138, 1µg/ml) overnight at +4°C. The secondary antibody (green) was Alexa Fluor® 488 goat anti-mouse IgG (H+L) used at a 1/1000 dilution for 1h. Alexa Fluor® 594 WGA was used to label plasma membranes (red) at a 1/200 dilution for 1h. DAPI was used to stain the cell nuclei (blue) at a concentration of 1.43µM.
This image was generated using the ascites version of the product.
-
Overlay histogram showing HEK293 cells stained with ab55138 (red line). The cells were fixed with 4% paraformaldehyde (10 min) and incubated in 1x PBS / 10% normal goat serum / 0.3M glycine to block non-specific protein-protein interactions. The cells were then incubated with the antibody (ab55138, 1µg/1x106 cells ) for 30 min at 22ºC. The secondary antibody used was DyLight® 488 goat anti-mouse IgG (H+L) (ab96879) at 1/500 dilution for 30 min at 22ºC. Isotype control antibody (black line) was mouse IgG2a [ICIGG2A] (ab91361, 1µg/1x106 cells) used under the same conditions. Acquisition of >5,000 events was performed. This antibody gave a positive signal in HEK293 cells fixed with 100% methanol used under the same conditions.
Please note that Abcam do not have any data for use of this antibody on non-fixed cells. We welcome any customer feedback.This image was generated using the ascites version of the product.

