Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category
Neuroscience Neurotransmitter Transporters GABA

Anti-GABA B Receptor 2/GABBR2 antibody [5G7F7] (ab181736)

Anti-GABA B Receptor 2/GABBR2 antibody [5G7F7] (ab181736)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)

Key features and details

  • Mouse monoclonal [5G7F7] to GABA B Receptor 2/GABBR2
  • Suitable for: IHC-P, WB, ICC/IF
  • Reacts with: Human, Recombinant fragment
  • Isotype: IgG2a

You may also be interested in

Product image
Anti-GABA Transporter 1 / GAT 1 antibody [EPR12998] - BSA and Azide free (ab249987)
Product image
Anti-GAD1 antibody [GAD1/2563] (ab237999)
Product image
Human ALDH9A1 knockout HEK-293T cell line (ab266777)
Product image
Anti-GABRB1 antibody [EPR10343] - BSA and Azide free (ab249128)

Overview

  • Product name

    Anti-GABA B Receptor 2/GABBR2 antibody [5G7F7]
    See all GABA B Receptor 2/GABBR2 primary antibodies
  • Description

    Mouse monoclonal [5G7F7] to GABA B Receptor 2/GABBR2
  • Host species

    Mouse
  • Tested applications

    Suitable for: IHC-P, WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human, Recombinant fragment
  • Immunogen

    Recombinant fragment corresponding to Human GABA B Receptor 2/GABBR2 aa 319-383 (internal sequence). Expressed in E. Coli.
    Sequence:

    FEPLSSKQIKTISGKTPQQYEREYNNKRSGVGPSKFHGYAYDGIWVIAKT LQRAMETLHASSRHQRIQDFNYTDHTLGRIILNAMNETNFFGVTGQVVFR NGERMGTIKFTQFQDSREVKVGEYNAVADTLEIINDTIRFQGSEPPKDKT IILEQLRKISLPLYS


    Database link: O75899
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • GABA B Receptor 2/GABBR2 (aa 319-483) recombinant protein; GABA B Receptor 2/GABBR2 (aa 319-483)-hIgGFc transfected HEK293 cell lysate; Hela cells; Human cerebellum tissue.
  • General notes

    This product was changed from ascites to supernatant. Lot no’s high than GR290583-1 are from Tissue Culture Supernatant

     This product was previously labelled as GABA B Receptor 2

     

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.05% Sodium azide
    Constituent: 99% PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purified from tissue culture supernatant.
  • Clonality

    Monoclonal
  • Clone number

    5G7F7
  • Isotype

    IgG2a
  • Research areas

    • Neuroscience
    • Neurotransmitter
    • Amino Acids
    • GABA
    • Neuroscience
    • Neurotransmission
    • Receptors / Channels
    • GPCR
    • More GPCR
    • Neuroscience
    • Neurotransmission
    • Receptors / Channels
    • Ligand-Gated Ion Channels
    • GABA Receptors

Images

  • Western blot - Anti-GABA B Receptor 2/GABBR2 antibody [5G7F7] (ab181736)
    Western blot - Anti-GABA B Receptor 2/GABBR2 antibody [5G7F7] (ab181736)
    All lanes : Anti-GABA B Receptor 2/GABBR2 antibody [5G7F7] (ab181736) at 1/500 dilution

    Lane 1 : non-transfected HEK293 cell lysate
    Lane 2 : GABA B Receptor 2/GABBR2 (aa 319-483)-hIgGFc transfected HEK293 cell lysate

    Predicted band size: 106 kDa

  • Immunocytochemistry/ Immunofluorescence - Anti-GABA B Receptor 2/GABBR2 antibody [5G7F7] (ab181736)
    Immunocytochemistry/ Immunofluorescence - Anti-GABA B Receptor 2/GABBR2 antibody [5G7F7] (ab181736)

    Immunofluorescent analysis of HeLa cells labeling GABA B Receptor 2/GABBR2 with ab181736 at 1/200 (green). Blue: DRAQ5 fluorescent DNA dye.

  • Western blot - Anti-GABA B Receptor 2/GABBR2 antibody [5G7F7] (ab181736)
    Western blot - Anti-GABA B Receptor 2/GABBR2 antibody [5G7F7] (ab181736)
    Anti-GABA B Receptor 2/GABBR2 antibody [5G7F7] (ab181736) at 1/500 dilution + GABA B Receptor 2/GABBR2 (aa 319-483) recombinant protein

    Predicted band size: 106 kDa

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-GABA B Receptor 2/GABBR2 antibody [5G7F7] (ab181736)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-GABA B Receptor 2/GABBR2 antibody [5G7F7] (ab181736)

    Immunohistochemical analysis of paraffin embedded Human cerebellum tissue labeling GABA B Receptor 2/GABBR2 with ab181736 at 1/200.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Alternative products to Anti-GABA B Receptor 2/GABBR2 antibody [5G7F7] (ab181736)

  •  
  • Product image

    Anti-GABA B Receptor 2/GABBR2 (phospho S893) antibody [EP2318Y] (ab68426)

    Applications: IHC-P, WB

  •  
  • Product image

    Anti-GABA B Receptor 2/GABBR2 antibody [EP2411Y] (ab75838)

    Applications: Flow Cyt, IHC-P, WB

  •  
  • Product image

    Anti-GABA B Receptor 2/GABBR2 (phospho S884) antibody [EP2317Y] (ab68425)

    Applications: WB

  •  
  • Product image

    Anti-GABA B Receptor 2/GABBR2 (phospho S783) antibody (ab72447)

    Applications: WB

  •  
  • Product image

    Anti-GABA B Receptor 2/GABBR2 antibody [EP2411Y] - BSA and Azide free (ab230136)

    Applications: Flow Cyt, IHC-P, WB

  •  
  • Product image

    Anti-GABA B Receptor 2/GABBR2 antibody (ab52248)

    Applications: IHC-FoFr, WB

Clear all

Recently viewed products

  •  
  • Product image

    Anti-TPM4 antibody [EPR13316] (ab181085)

  •  
  • Product image

    Anti-PPP2R1B antibody [EPR10159] (ab154833)

  •  
  • Product image

    Anti-BAZ2B antibody [EPR20909-88] (ab234420)

  •  
  • Product image

    Anti-BST2/Tetherin antibody [EPR23597-266] (ab272169)

  •  
  • Product image

    Anti-SSBP2 antibody [EPR11520] (ab177944)

  •  
  • Product image

    Anti-TMF antibody [EPR10671(B)] (ab151702)

Get resources and offers direct to your inbox Sign up
© 2021 Astana Biomed Group LLP. All rights reserved.