Anti-GABA B Receptor 2/GABBR2 antibody [5G7F7] (ab181736)
Key features and details
- Mouse monoclonal [5G7F7] to GABA B Receptor 2/GABBR2
- Suitable for: IHC-P, WB, ICC/IF
- Reacts with: Human, Recombinant fragment
- Isotype: IgG2a
Overview
-
Product name
Anti-GABA B Receptor 2/GABBR2 antibody [5G7F7]
See all GABA B Receptor 2/GABBR2 primary antibodies -
Description
Mouse monoclonal [5G7F7] to GABA B Receptor 2/GABBR2 -
Host species
Mouse -
Tested applications
Suitable for: IHC-P, WB, ICC/IFmore details -
Species reactivity
Reacts with: Human, Recombinant fragment -
Immunogen
Recombinant fragment corresponding to Human GABA B Receptor 2/GABBR2 aa 319-383 (internal sequence). Expressed in E. Coli.
Sequence:FEPLSSKQIKTISGKTPQQYEREYNNKRSGVGPSKFHGYAYDGIWVIAKT LQRAMETLHASSRHQRIQDFNYTDHTLGRIILNAMNETNFFGVTGQVVFR NGERMGTIKFTQFQDSREVKVGEYNAVADTLEIINDTIRFQGSEPPKDKT IILEQLRKISLPLYS
Database link: O75899 -
Positive control
- GABA B Receptor 2/GABBR2 (aa 319-483) recombinant protein; GABA B Receptor 2/GABBR2 (aa 319-483)-hIgGFc transfected HEK293 cell lysate; Hela cells; Human cerebellum tissue.
-
General notes
This product was changed from ascites to supernatant. Lot no’s high than GR290583-1 are from Tissue Culture Supernatant
This product was previously labelled as GABA B Receptor 2
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.05% Sodium azide
Constituent: 99% PBS -
Concentration information loading... -
Purity
Protein G purified -
Purification notes
Purified from tissue culture supernatant. -
Clonality
Monoclonal -
Clone number
5G7F7 -
Isotype
IgG2a -
Research areas
Images
-
All lanes : Anti-GABA B Receptor 2/GABBR2 antibody [5G7F7] (ab181736) at 1/500 dilution
Lane 1 : non-transfected HEK293 cell lysate
Lane 2 : GABA B Receptor 2/GABBR2 (aa 319-483)-hIgGFc transfected HEK293 cell lysate
Predicted band size: 106 kDa
-
Immunofluorescent analysis of HeLa cells labeling GABA B Receptor 2/GABBR2 with ab181736 at 1/200 (green). Blue: DRAQ5 fluorescent DNA dye.
-
Anti-GABA B Receptor 2/GABBR2 antibody [5G7F7] (ab181736) at 1/500 dilution + GABA B Receptor 2/GABBR2 (aa 319-483) recombinant protein
Predicted band size: 106 kDa
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-GABA B Receptor 2/GABBR2 antibody [5G7F7] (ab181736)Immunohistochemical analysis of paraffin embedded Human cerebellum tissue labeling GABA B Receptor 2/GABBR2 with ab181736 at 1/200.

