Anti-Fibronectin antibody [IST-9] (ab6328)
Key features and details
- Mouse monoclonal [IST-9] to Fibronectin
- Suitable for: IHC-P
- Reacts with: Rat, Dog, Human
- Isotype: IgG1
Overview
-
Product name
Anti-Fibronectin antibody [IST-9]
See all Fibronectin primary antibodies -
Description
Mouse monoclonal [IST-9] to Fibronectin -
Host species
Mouse -
Specificity
This antibody reacts with an epitope (PEDGIHELFP) located in the ED-A sequence of cellular fibronectin (it therefore only detects the cFN and not extracellular FN (plasma FN)). (Liao et al.) The ED-A segment can be included or omitted from the molecule depending on the pattern of splicing of the mRNA precursors. In transformed or tumour derived cells the ED-A segment is about 10-times higher than in FN from normal fibroblasts, and it may therefore be a significant marker for malignancy (Borsi et al., and others). -
Tested applications
Suitable for: IHC-Pmore details -
Species reactivity
Reacts with: Rat, Dog, Human
Predicted to work with: Mouse, Rabbit
-
Immunogen
Recombinant fragment corresponding to Human Fibronectin aa 1631-1721. Sequence of the type III repeats termed EIIIA (or ED-A).
Sequence:NIDRPKGLAFTDVDVDSIKIAWESPQGQVSRYRVTYSSPEDGIHELFPAP DGEEDTAELQ GLRPGSEYTVSVVALHDDMESQPLIGTQSTA
Database link: P02751 -
Epitope
Liao et al: Clone IST-9, binds to the Ile43 and His44 residues within ED-A in a conformationally dependent fashion, implicating the loop region encompassing both residues as critical for mediating ED-A function. The conformational domain C-C'-E of rat EIIIA encompassing the His44 residue is crucial for constituting the IST-9 epitope. -
Positive control
- IHC-P: Canine myocardial infarct. tissue. Rat kidney tissue. Human small intestine tissue.
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing the problem with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation.
One factor contributing to the crisis is the use of antibodies that are not suitable. This can lead to misleading results and the use of incorrect data informing project assumptions and direction. To help address this challenge, we have introduced an application and species grid on our primary antibody datasheets to make it easy to simplify identification of the right antibody for your needs.
Learn more here.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. -
Storage buffer
Constituent: PBS -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Monoclonal -
Clone number
IST-9 -
Isotype
IgG1 -
Research areas
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Fibronectin antibody [IST-9] (ab6328) Amann et al PLoS One. 2014 Mar 24;9(3):e92511. doi: 10.1371/journal.pone.0092511. eCollection 2014. Fig 3. Reproduced under the Creative Commons license http://creativecommons.org/licenses/by/4.0/Extracellular matrix expression pattern.
Fibronectin was displayed in microtissues after ten days. (Bar in A549/SV80 monocultures: 50 μm, bar in all other microtissues: 100 μm); Secretion of fibronectin could be observed in microtissues containing fibroblasts, whereas in all tumour cell monocultures no fibronectin secretion could be detected.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Fibronectin antibody [IST-9] (ab6328) This image is courtesy of an Abreview submitted by Marcin Dobaczewskiab6328 positively staining paraffin fixed canine myocardial infarct. tissue (1/200). The images demonstrate the time course of fibronectin deposition in reperfused canine myocaridal infarcts.
a: 24 hrs
b: 7 days
c: 28 days of reperfusion.
Secondary: Biotin conjugated goat anti mouse. Detection was achieved using DAB. -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Fibronectin antibody [IST-9] (ab6328) This image is courtesy of an Abreview submitted by Elizabeth ChlipalaFormalin fixed paraffin embedded rat kidney stained with ab6328 at a dilution of 1:100 after proteinase K digestion.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Fibronectin antibody [IST-9] (ab6328) This image is courtesy of an Abreview submitted by Rudolf Jungab6328 staining Fibronectin in human small intestine tissue sections by Immunohistochemistry (IHC-P - paraformaldehyde-fixed, paraffin-embedded sections).
Tissue was fixed with paraformaldehyde and antigen retrieval was by heat mediation in a Tris-EDTA buffer pH 9.0. Samples were incubated with primary antibody (1/50 in blocking buffer) for 30 minutes at 20°C. An undiluted HRP-conjugated Goat anti-mouse polyclonal was used as the secondary antibody.

