Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category
Signal Transduction Cytoskeleton / ECM Extracellular Matrix

Anti-Fibronectin antibody [IST-9] (ab6328)

Price and availability

358 492 ₸

Availability

Order now and get it on Wednesday March 03, 2021

Anti-Fibronectin antibody [IST-9] (ab6328)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)

Key features and details

  • Mouse monoclonal [IST-9] to Fibronectin
  • Suitable for: IHC-P
  • Reacts with: Rat, Dog, Human
  • Isotype: IgG1

You may also be interested in

Product image
Alexa Fluor® 647 Anti-Fibronectin antibody [F14] (ab246736)
Product image
Anti-Fibronectin antibody [F14] (ab45688)
Product image
Anti-Cathepsin K antibody - Catalytic domain (ab49893)
Recombinant Human Fibronectin protein (ab187878)

Overview

  • Product name

    Anti-Fibronectin antibody [IST-9]
    See all Fibronectin primary antibodies
  • Description

    Mouse monoclonal [IST-9] to Fibronectin
  • Host species

    Mouse
  • Specificity

    This antibody reacts with an epitope (PEDGIHELFP) located in the ED-A sequence of cellular fibronectin (it therefore only detects the cFN and not extracellular FN (plasma FN)). (Liao et al.) The ED-A segment can be included or omitted from the molecule depending on the pattern of splicing of the mRNA precursors. In transformed or tumour derived cells the ED-A segment is about 10-times higher than in FN from normal fibroblasts, and it may therefore be a significant marker for malignancy (Borsi et al., and others).
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Rat, Dog, Human
    Predicted to work with: Mouse, Rabbit
  • Immunogen

    Recombinant fragment corresponding to Human Fibronectin aa 1631-1721. Sequence of the type III repeats termed EIIIA (or ED-A).
    Sequence:

    NIDRPKGLAFTDVDVDSIKIAWESPQGQVSRYRVTYSSPEDGIHELFPAP DGEEDTAELQ GLRPGSEYTVSVVALHDDMESQPLIGTQSTA


    Database link: P02751
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Epitope

    Liao et al: Clone IST-9, binds to the Ile43 and His44 residues within ED-A in a conformationally dependent fashion, implicating the loop region encompassing both residues as critical for mediating ED-A function. The conformational domain C-C'-E of rat EIIIA encompassing the His44 residue is crucial for constituting the IST-9 epitope.
  • Positive control

    • IHC-P: Canine myocardial infarct. tissue. Rat kidney tissue. Human small intestine tissue.
  • General notes

    The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing the problem with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation.

    One factor contributing to the crisis is the use of antibodies that are not suitable. This can lead to misleading results and the use of incorrect data informing project assumptions and direction. To help address this challenge, we have introduced an application and species grid on our primary antibody datasheets to make it easy to simplify identification of the right antibody for your needs.

    Learn more here.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
  • Storage buffer

    Constituent: PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Monoclonal
  • Clone number

    IST-9
  • Isotype

    IgG1
  • Research areas

    • Cardiovascular
    • Angiogenesis
    • Adhesion / ECM
    • Extracellular Matrix
    • Signal Transduction
    • Cytoskeleton / ECM
    • Extracellular Matrix
    • ECM Proteins
    • Fibronectin
    • Stem Cells
    • Lineage Markers
    • Ectoderm
    • Stem Cells
    • Neural Stem Cells
    • Extracellular
    • Stem Cells
    • Mesenchymal Stem Cells
    • Osteogenesis
    • Cancer
    • Invasion/microenvironment
    • ECM
    • Extracellular matrix
    • Other
    • Developmental Biology
    • Lineage specification
    • Ectoderm

Images

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Fibronectin antibody [IST-9] (ab6328)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Fibronectin antibody [IST-9] (ab6328) Amann et al PLoS One. 2014 Mar 24;9(3):e92511. doi: 10.1371/journal.pone.0092511. eCollection 2014. Fig 3. Reproduced under the Creative Commons license http://creativecommons.org/licenses/by/4.0/

    Extracellular matrix expression pattern.

    Fibronectin was displayed in microtissues after ten days. (Bar in A549/SV80 monocultures: 50 μm, bar in all other microtissues: 100 μm); Secretion of fibronectin could be observed in microtissues containing fibroblasts, whereas in all tumour cell monocultures no fibronectin secretion could be detected.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Fibronectin antibody [IST-9] (ab6328)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Fibronectin antibody [IST-9] (ab6328) This image is courtesy of an Abreview submitted by Marcin Dobaczewski

    ab6328 positively staining paraffin fixed canine myocardial infarct. tissue (1/200). The images demonstrate the time course of fibronectin deposition in reperfused canine myocaridal infarcts.
    a: 24 hrs
    b: 7 days
    c: 28 days of reperfusion.

    Secondary: Biotin conjugated goat anti mouse. Detection was achieved using DAB.

    See Abreview

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Fibronectin antibody [IST-9] (ab6328)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Fibronectin antibody [IST-9] (ab6328) This image is courtesy of an Abreview submitted by Elizabeth Chlipala

    Formalin fixed paraffin embedded rat kidney stained with ab6328 at a dilution of 1:100 after proteinase K digestion.

     

    See Abreview

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Fibronectin antibody [IST-9] (ab6328)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Fibronectin antibody [IST-9] (ab6328) This image is courtesy of an Abreview submitted by Rudolf Jung

    ab6328 staining Fibronectin in human small intestine tissue sections by Immunohistochemistry (IHC-P - paraformaldehyde-fixed, paraffin-embedded sections).

    Tissue was fixed with paraformaldehyde and antigen retrieval was by heat mediation in a Tris-EDTA buffer pH 9.0. Samples were incubated with primary antibody (1/50 in blocking buffer) for 30 minutes at 20°C. An undiluted HRP-conjugated Goat anti-mouse polyclonal was used as the secondary antibody.

    See Abreview

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Alternative products to Anti-Fibronectin antibody [IST-9] (ab6328)

  •  
  • Product image

    Anti-Fibronectin antibody [F14] - BSA and Azide free (ab206928)

    Applications: Flow Cyt, ICC/IF, WB

  •  
  • Product image

    Alexa Fluor® 488 Anti-Fibronectin antibody [F1] (ab198933)

    Applications: Flow Cyt, ICC/IF, IHC-P

  •  
  • Product image

    Alexa Fluor® 647 Anti-Fibronectin antibody [F1] (ab198934)

    Applications: ICC, IHC-P

  •  
  • Product image

    Anti-Fibronectin antibody [F1] - BSA and Azide free (ab271831)

    Applications: Flow Cyt, ICC/IF, IHC-Fr, IHC-P, WB

  •  
  • Product image

    Anti-Fibronectin antibody [F1] (ab32419)

    Applications: Flow Cyt, ICC/IF, IHC-P, WB

  •  
  • Product image

    Anti-Fibronectin antibody [F14] (ab45688)

    Applications: Flow Cyt, ICC/IF, WB

  •  
  • Product image

    HRP Anti-Fibronectin antibody [F14] (ab207628)

    Applications: WB

Clear all

Recently viewed products

  •  
  • Product image

    Anti-SPAK antibody [EPR6394] (ab128894)

  •  
  • Product image

    Anti-IL-33 antibody [EPR17831] (ab187060)

  •  
  • Product image

    Anti-E Cadherin antibody [M168] - C-terminal (ab76055)

  •  
  • Product image

    Anti-Trefoil Factor 3 antibody [EPR3974] (ab108599)

  •  
  • Product image

    Anti-TCF21 antibody [EPR13449] (ab182134)

  •  
  • Product image

    Anti-MEF2C antibody [EPR1452(N)] (ab191428)

Get resources and offers direct to your inbox Sign up
© 2021 Astana Biomed Group LLP. All rights reserved.