Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category
Signal Transduction Metabolism Lipid metabolism

Anti-FATP2 antibody [6B3A9] (ab175373)

Anti-FATP2 antibody [6B3A9] (ab175373)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)

Key features and details

  • Mouse monoclonal [6B3A9] to FATP2
  • Suitable for: IHC-P, WB
  • Reacts with: Human
  • Isotype: IgG1

You may also be interested in

Product image
Anti-SCD1 antibody (ab39969)
Product image
Anti-LASS3 antibody (ab169259)
Product image
Anti-12 Lipoxygenase/ALOX12 antibody - C-terminal (ab211506)
Product image
Mouse Liver-FABP Matched Antibody Pair Kit (ab220137)

Overview

  • Product name

    Anti-FATP2 antibody [6B3A9]
    See all FATP2 primary antibodies
  • Description

    Mouse monoclonal [6B3A9] to FATP2
  • Host species

    Mouse
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human FATP2 aa 346-405. Expressed in E. Coli.
    Sequence:

    WRQFVKRFGDICIYEFYAATEGNIGFMNYARKVGAVGRVNYLQKKIITYD LIKYDVEKDE


    Database link: O14975
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • Human FATP2 recombinant protein; FATP2 (aa: 346-405)-hIgGFc transfected HEK293 cell lysate; Human liver and esophageal cancer tissues
  • General notes

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.05% Sodium azide
    Constituent: 99% PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purified from tissue culture supernatant.
  • Clonality

    Monoclonal
  • Clone number

    6B3A9
  • Isotype

    IgG1
  • Research areas

    • Signal Transduction
    • Metabolism
    • Lipid metabolism
    • Cardiovascular
    • Lipids / Lipoproteins
    • Fatty Acids
    • Metabolism
    • Cancer
    • Cancer Metabolism
    • Metabolic signaling pathway
    • Metabolism of lipids and lipoproteins
    • Metabolism
    • Pathways and Processes
    • Metabolic signaling pathways
    • Lipid and lipoprotein metabolism
    • Lipid metabolism
    • Metabolism
    • Pathways and Processes
    • Metabolic signaling pathways
    • Lipid and lipoprotein metabolism
    • Fatty acids
    • Metabolism
    • Pathways and Processes
    • Redox metabolism
    • Fatty acid oxidation

Images

  • Western blot - Anti-FATP2 antibody [6B3A9] (ab175373)
    Western blot - Anti-FATP2 antibody [6B3A9] (ab175373)
    All lanes : Anti-FATP2 antibody [6B3A9] (ab175373) at 1/500 dilution

    Lane 1 : Non transfected HEK293 cell lysate
    Lane 2 : FATP2 (aa: 346-405)-hIgGFc transfected HEK293 cell lysate

    Predicted band size: 70 kDa



    Expected MW is 32.4 kDa

  • Western blot - Anti-FATP2 antibody [6B3A9] (ab175373)
    Western blot - Anti-FATP2 antibody [6B3A9] (ab175373)
    Anti-FATP2 antibody [6B3A9] (ab175373) at 1/500 dilution + Human FATP2 recombinant protein

    Predicted band size: 70 kDa



    Expected MW is 32.4 kDa

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-FATP2 antibody [6B3A9] (ab175373)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-FATP2 antibody [6B3A9] (ab175373)

    Immunohistochemical analysis of paraffin-embedded Human esophageal cancer tissue labeling FATP2 using ab175373 at 1/200 dilution, followed by with DAB staining.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-FATP2 antibody [6B3A9] (ab175373)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-FATP2 antibody [6B3A9] (ab175373)

    Immunohistochemical analysis of paraffin-embedded Human liver cancer tissue labeling FATP2 using ab175373 at 1/200 dilution, followed by with DAB staining.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Alternative products to Anti-FATP2 antibody [6B3A9] (ab175373)

  •  
  • Product image

    Anti-FATP2 antibody (ab228784)

    Applications: IHC-P, WB

Clear all

Recently viewed products

  •  
  • Product image

    Anti-C9 antibody [EPR11232] (ab168345)

  •  
  • Product image

    Anti-UCH37 antibody [EP4897] (ab133508)

  •  
  • Product image

    Anti-SNRPD3/Sm-D3 antibody (ab157124)

  •  
  • Product image

    Anti-POLD2 antibody - C-terminal (ab187710)

  •  
  • Product image

    PPADS, P2 purinergic receptor antagonist (ab120009)

  •  
  • Product image

    Human SCAF11 (SFRS2IP) knockout HeLa cell line (ab265343)

Get resources and offers direct to your inbox Sign up
© 2021 Astana Biomed Group LLP. All rights reserved.