Anti-Ephrin A2 antibody [OTI3E3] (ab123877)
![Anti-Ephrin A2 antibody [OTI3E3] (ab123877)](https://www.abcam.com/ps/products/123/ab123877/Images/ab123877-137053-anti-ephrin-a2-antibody-oti3e3-immunofluorescence.jpg "Anti-Ephrin A2 antibody [OTI3E3] (ab123877)")
Key features and details
- Mouse monoclonal [OTI3E3] to Ephrin A2
- Suitable for: WB, IHC-P, Flow Cyt, ICC/IF
- Reacts with: Human, African green monkey
- Isotype: IgG2b
Overview
-
Product name
Anti-Ephrin A2 antibody [OTI3E3] -
Description
Mouse monoclonal [OTI3E3] to Ephrin A2 -
Host species
Mouse -
Tested Applications & Species
See all applications and species dataApplication Species Flow Cyt HumanICC/IF African green monkeyIHC-P HumanWB Human
-
Immunogen
Recombinant full length protein corresponding to Human Ephrin A2 aa 1-213. Produced in HEK293T cells (NP_001396).
Sequence:MAPAQRPLLPLLLLLLPLPPPPFARAEDAARANSDRYAVYWNRSNPRFHA GAGDDGGGYTVEVSINDYLDIYCPHYGAPLPPAERMEHYVLYMVNGEGHA SCDHRQRGFKRWECNRPAAPGGPLKFSEKFQLFTPFSLGFEFRPGHEYYY ISATPPNAVDRPCLRLKVYVRPTNETLYEAPEPIFTSNNSCSSPGGCRLF LSTIPVLWTLLGS
Database link: O43921 -
Positive control
- WB: HEK293T cells transfected pCMV6-ENTRY Ephrin A2 cDNA. IHC-P: Human endometrium adenocarcinoma tissue. ICC/IF:COS7 cells transiently transfected by pCMV6-ENTRY Ephrin A2. Flow: Jurkat cells.
-
General notes
The clone number has been updated from 3E3 to OTI3E3, both clone numbers name the same clone.
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing the problem with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation.
One factor contributing to the crisis is the use of antibodies that are not suitable. This can lead to misleading results and the use of incorrect data informing project assumptions and direction. To help address this challenge, we have introduced an application and species grid on our primary antibody datasheets to make it easy to simplify identification of the right antibody for your needs.
Learn more here.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.30
Preservative: 0.02% Sodium azide
Constituents: 1% BSA, 50% Glycerol, PBS -
Concentration information loading... -
Purity
Affinity purified -
Purification notes
Purified from cell culture supernatant by affinity chromatography -
Clonality
Monoclonal -
Clone number
OTI3E3 -
Isotype
IgG2b -
Research areas
Images
-
Immunocytochemistry/ Immunofluorescence - Anti-Ephrin A2 antibody [OTI3E3] (ab123877)
COS-7 (African green monkey kidney fibroblast-like cell line) cells transiently transfected by pCMV6-ENTRY Ephrin A2, stained for Epherin A2 (Green) using ab123877 at 1/100 dilution in ICC/IF.
-
![Western blot - Anti-Ephrin A2 antibody [OTI3E3] (ab123877)](https://www.abcam.com/ps/products/123/ab123877/Images/ab123877-137055-anti-ephrin-a2-antibody-oti3e3-western-blot.jpg)
Western blot - Anti-Ephrin A2 antibody [OTI3E3] (ab123877)All lanes : Anti-Ephrin A2 antibody [OTI3E3] (ab123877) at 1/2000 dilution
Lane 1 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cells transfected with pCMV6-ENTRY control cDNA
Lane 2 : HEK-293T cells transfected with pCMV6-ENTRY Ephrin A2 cDNA
Lysates/proteins at 5 µg per lane.
Predicted band size: 24 kDa
-
![Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Ephrin A2 antibody [OTI3E3] (ab123877)](https://www.abcam.com/ps/products/123/ab123877/Images/ab123877-137054-anti-ephrin-a2-antibody-oti3e3-immunohistochemistry.jpg)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Ephrin A2 antibody [OTI3E3] (ab123877)Paraffin-embedded human endometrium tissue stained for Ephrin A2 using ab123877 at 1/100 dilution in immunohistochemical analysis.
-
![Flow Cytometry - Anti-Ephrin A2 antibody [OTI3E3] (ab123877)](https://www.abcam.com/ps/products/123/ab123877/Images/ab123877-137052-anti-ephrin-a2-antibody-oti3e3-flow-cytometry.jpg)
Flow Cytometry - Anti-Ephrin A2 antibody [OTI3E3] (ab123877)ab123877 at 1/100 dilution staining Ephrin-A2 in Jurkat cells by Flow cytometry (Red) compared to a nonspecific negative control antibody (Blue).