Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category
Signal Transduction Metabolism Amino Acids

Anti-DPD antibody (ab180609)

Price and availability

291 484 ₸

Availability

Order now and get it on Wednesday March 03, 2021

Anti-DPD antibody (ab180609)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)

Key features and details

  • Rabbit polyclonal to DPD
  • Suitable for: IHC-P, WB
  • Reacts with: Mouse, Human
  • Isotype: IgG

You may also be interested in

Product image
Anti-NIT2 antibody (ab203245)
Recombinant Human Methionine Aminopeptidase 2/p67 protein (ab168057)
Product image
Rat ALT ELISA Kit (ab234579)
Product image
Recombinant Human HPD protein (ab99868)

Overview

  • Product name

    Anti-DPD antibody
    See all DPD primary antibodies
  • Description

    Rabbit polyclonal to DPD
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant full length protein corresponding to Human DPD aa 1-173.
    Sequence:

    MAPVLSKDSADIESILALNPRTQTHATLCSTSAKKLDKKHWKRNPDKNCF NCEKLENNFDDIKHTTLGERGALREAMRCLKCADAPCQKSCPTNLDIKSF ITSIANKNYYGAAKMIFSDNPLGLTCGMVCPTSDLCVGGCNLYATEEGPI NIGGLQQFATETLILAFSLMNHL


    Database link: Q12882-2
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • THP-1 and HeLa cell extracts.
  • General notes

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.30
    Preservative: 0.02% Sodium azide
    Constituents: 49% PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

    • Signal Transduction
    • Metabolism
    • Amino Acids
    • Signal Transduction
    • Metabolism
    • Energy Metabolism
    • Metabolism
    • Pathways and Processes
    • Metabolic signaling pathways
    • Amino acid metabolism
    • Metabolism
    • Pathways and Processes
    • Metabolic signaling pathways
    • Energy transfer pathways
    • Energy Metabolism

Images

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-DPD antibody (ab180609)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-DPD antibody (ab180609)

    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of mouse lung tissue labelling DPD with ab180609 at 1/100. Magnification: 200x.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-DPD antibody (ab180609)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-DPD antibody (ab180609)

    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human stomach cancer tissue labelling DPD with ab180609 at 1/100. Magnification: 200x.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-DPD antibody (ab180609)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-DPD antibody (ab180609)

    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human lung cancer tissue labelling DPD with ab180609 at 1/100. Magnification: 200x.

  • Western blot - Anti-DPD antibody (ab180609)
    Western blot - Anti-DPD antibody (ab180609)
    All lanes : Anti-DPD antibody (ab180609) at 1/500 dilution

    Lane 1 : THP-1 cell extract
    Lane 2 : HeLa cell extract

    Predicted band size: 19, 111 kDa

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Alternative products to Anti-DPD antibody (ab180609)

  •  
  • Product image

    Alexa Fluor® 647 Anti-DPD antibody [EPR8811] (ab209933)

    Applications: ICC/IF

  •  
  • Product image

    Anti-DPD antibody [EPR8811] (ab134922)

    Applications: Flow Cyt, ICC/IF, IHC-P, WB

  •  
  • Product image

    Anti-DPD antibody [EPR8811] - BSA and Azide free (ab231701)

    Applications: Flow Cyt, ICC/IF, IHC-P, WB

  •  
  • Product image

    Anti-DPD antibody (ab54797)

    Applications: Flow Cyt, ICC/IF, WB

Clear all

Recently viewed products

  •  
  • Product image

    Anti-ABL2 antibody (ab126256)

  •  
  • Product image

    Recombinant human GM-CSF protein (ab88382)

  •  
  • Product image

    Anti-AP1M2 antibody (ab220678)

  •  
  • Product image

    Recombinant Human IFIT2 protein (ab132593)

  •  
  • Product image

    Recombinant human Adiponectin protein (ab78588)

  •  
  • Product image

    Anti-Lysozyme antibody (ab391)

Get resources and offers direct to your inbox Sign up
© 2021 Astana Biomed Group LLP. All rights reserved.