Anti-Cofilin antibody (ab54532)
Key features and details
- Mouse monoclonal to Cofilin
- Suitable for: WB, IHC-P, ICC/IF
- Reacts with: Mouse, Rat, Human
- Isotype: IgG2a
Overview
-
Product name
Anti-Cofilin antibody
See all Cofilin primary antibodies -
Description
Mouse monoclonal to Cofilin -
Host species
Mouse -
Tested Applications & Species
See all applications and species dataApplication Species ICC/IF HumanIHC-P HumanWB MouseRatHuman -
Immunogen
Recombinant full length protein (GST-tag) corresponding to Human Cofilin. AAH11005
Sequence:MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILE EGKEILVGDVGQTVDDPYATFAKMLPDKDCRYALYDATYETKESKKEDLV FIFWAPESAPLKSKMIYASSKDAIKKKLTGIKHELQANCYEGVKDRCTLA EKLGGSAVISLEGKPL
Database link: P23528 -
Positive control
- WB: HeLa, PC-12 and NIH/3T3 cell lysate. IHC-P: Human breast cancer tissue. ICC/IF: HeLa cells.
-
General notes
This product was changed from ascites to tissue culture supernatant on 17/04/2019. Please note that the dilutions may need to be adjusted accordingly. If you have any questions, please do not hesitate to contact our scientific support team.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. -
Storage buffer
pH: 7.40
Constituent: PBS -
Concentration information loading... -
Purity
Tissue culture supernatant -
Clonality
Monoclonal -
Isotype
IgG2a -
Light chain type
kappa -
Research areas
Images
-
Anti-Cofilin antibody (ab54532) at 1 µg + HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate at 25 µg
Predicted band size: 18 kDaThis image was generated using the ascites version of the product
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Cofilin antibody (ab54532)Formalin-fixed, paraffin-embedded human breast cancer tissue stained for Cofilin with ab54532 at 1.5 µg/ml in immunohistochemical analysis.
This image was generated using the ascites version of the product.
-
HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for Cofilin (green) using ab54532 at 10 µg/ml in ICC/IF.
This image was generated using the ascites version of the product.
-
Anti-Cofilin antibody (ab54532) at 1 µg/ml + NIH/3T3 (mouse embryo fibroblast cell line) cell lysate
Predicted band size: 18 kDaThis image was generated using the ascites version of the product.
-
Anti-Cofilin antibody (ab54532) at 1 µg/ml + PC-12 (rat adrenal gland pheochromocytoma cell line) cell lysate
Predicted band size: 18 kDaThis image was generated using the ascites version of the product.

