Anti-CDKN2A/p16INK4a antibody [DCS50.1] (ab16123)
Key features and details
- Mouse monoclonal [DCS50.1] to CDKN2A/p16INK4a
- Suitable for: ICC/IF, IHC-P, WB, Flow Cyt
- Reacts with: Human
- Isotype: IgG1
Overview
-
Product name
Anti-CDKN2A/p16INK4a antibody [DCS50.1]
See all CDKN2A/p16INK4a primary antibodies -
Description
Mouse monoclonal [DCS50.1] to CDKN2A/p16INK4a -
Host species
Mouse -
Specificity
This antibody shows no cross reactivity with the closely related inhibitors p15INK4b and p18INK4c. -
Tested Applications & Species
See all applications and species dataApplication Species Flow Cyt HumanICC/IF HumanWB Human -
Immunogen
Recombinant full length protein corresponding to Human CDKN2A/p16INK4a aa 1-156.
Sequence:MEPAAGSSMEPSADWLATAAARGRVEEVRALLEAGALPNAPNSYGRRPIQ VMMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRA GARLDVRDAWGRLPVDLAEELGHRDVARYLRAAAGGTRGSNHARIDAAEG PSDIPD
Database link: P42771 -
Positive control
- WB: HEK-293 and HeLa cell lysates. Flow cyt: HEK-293 cells. IHC-P: Bladder tumor tissue. ICC/IF: Hepp cells.
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing the problem with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation.
One factor contributing to the crisis is the use of antibodies that are not suitable. This can lead to misleading results and the use of incorrect data informing project assumptions and direction. To help address this challenge, we have introduced an application and species grid on our primary antibody datasheets to make it easy to simplify identification of the right antibody for your needs.
Learn more here.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.08% Sodium azide
Constituent: 99.9% PBS -
Concentration information loading... -
Purity
Protein A/G purified -
Clonality
Monoclonal -
Clone number
DCS50.1 -
Isotype
IgG1 -
Research areas
Images
-
All lanes : Anti-CDKN2A/p16INK4a antibody [DCS50.1] (ab16123) at 1 µg/ml
Lane 1 : HeLa (Human epithelial carcinoma cell line) Whole Cell Lysate
Lane 2 : HEK293 (Human embryonic kidney cell line) Whole Cell Lysate
Lysates/proteins at 10 µg per lane.
Secondary
All lanes : Goat Anti-Mouse IgG H&L (HRP) preadsorbed (ab97040) at 1/5000 dilution
Developed using the ECL technique.
Performed under reducing conditions.
Predicted band size: 16 kDa
Observed band size: 16 kDa
Additional bands at: 37 kDa, 50 kDa. We are unsure as to the identity of these extra bands.
Exposure time: 12 minutes
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CDKN2A/p16INK4a antibody [DCS50.1] (ab16123)Immunohistochemical analysis of formalin-fixed, paraffin-embedded bladder tumor tissue labelling CDKN2A/p16INK4a with ab16123 at 10µg/ml.
-
ICC/IF image of ab16123 stained Hepp cells. The cells were 4% formaldehyde fixed (10 min) and then incubated in 1%BSA / 10% normal goat serum / 0.3M glycine in 0.1% PBS-Tween for 1h to permeabilise the cells and block non-specific protein-protein interactions. The cells were then incubated with the antibody (ab16123, 1µg/ml) overnight at +4°C. The secondary antibody (green) was Alexa Fluor® 488 goat anti-mouse IgG (H+L) ab150113) used at a 1/1000 dilution for 1h. Alexa Fluor® 594 WGA was used to label plasma membranes (red) at a 1/200 dilution for 1h. DAPI was used to stain the cell nuclei (blue) at a concentration of 1.43µM.
-
Overlay histogram showing HEK293 cells stained with ab16123 (red line). The cells were fixed with 4% paraformaldehyde (10 min) and incubated in 1x PBS / 10% normal goat serum / 0.3M glycine to block non-specific protein-protein interactions. The cells were then incubated with the antibody (ab16123, 1µg/1x106 cells ) for 30 min at 22ºC. The secondary antibody used was DyLight® 488 goat anti-mouse IgG (H+L) (ab96879) at 1/500 dilution for 30 min at 22ºC. Isotype control antibody (black line) was mouse IgG1 [ICIGG1] (ab91353, 2µg/1x106 cells) used under the same conditions. Acquisition of >5,000 events was performed. This antibody gave a positive signal in HEK293 cells fixed with 100% methanol used under the same conditions.
Please note that Abcam do not have any data for use of this antibody on non-fixed cells. We welcome any customer feedback.

