Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category
Cancer Cell cycle Cell cycle inhibitors Ink4

Anti-CDKN2A/p16INK4a antibody [DCS50.1] (ab16123)

Price and availability

268 032 ₸

Availability

Order now and get it on Tuesday March 09, 2021

Anti-CDKN2A/p16INK4a antibody [DCS50.1] (ab16123)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)

Key features and details

  • Mouse monoclonal [DCS50.1] to CDKN2A/p16INK4a
  • Suitable for: ICC/IF, IHC-P, WB, Flow Cyt
  • Reacts with: Human
  • Isotype: IgG1

You may also be interested in

Product image
Recombinant Human CDKN2A/p16INK4a protein (ab84075)
Product image
Anti-CDKN2A/p16INK4a antibody [EPR20418] - BSA and Azide free (ab232402)
Product image
Anti-p15 INK4b antibody (ab53034)
Product image
Anti-CDKN2A/p14ARF antibody [SP271] - BSA and Azide free (ab271999)

Overview

  • Product name

    Anti-CDKN2A/p16INK4a antibody [DCS50.1]
    See all CDKN2A/p16INK4a primary antibodies
  • Description

    Mouse monoclonal [DCS50.1] to CDKN2A/p16INK4a
  • Host species

    Mouse
  • Specificity

    This antibody shows no cross reactivity with the closely related inhibitors p15INK4b and p18INK4c.
  • Tested Applications & Species

    Application Species
    Flow Cyt
    Human
    ICC/IF
    Human
    WB
    Human
    See all applications and species data
  • Immunogen

    Recombinant full length protein corresponding to Human CDKN2A/p16INK4a aa 1-156.
    Sequence:

    MEPAAGSSMEPSADWLATAAARGRVEEVRALLEAGALPNAPNSYGRRPIQ VMMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRA GARLDVRDAWGRLPVDLAEELGHRDVARYLRAAAGGTRGSNHARIDAAEG PSDIPD


    Database link: P42771
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • WB: HEK-293 and HeLa cell lysates. Flow cyt: HEK-293 cells. IHC-P: Bladder tumor tissue. ICC/IF: Hepp cells.
  • General notes

    The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing the problem with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation.

    One factor contributing to the crisis is the use of antibodies that are not suitable. This can lead to misleading results and the use of incorrect data informing project assumptions and direction. To help address this challenge, we have introduced an application and species grid on our primary antibody datasheets to make it easy to simplify identification of the right antibody for your needs.

    Learn more here.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.08% Sodium azide
    Constituent: 99.9% PBS
  • Concentration information loading...
  • Purity

    Protein A/G purified
  • Clonality

    Monoclonal
  • Clone number

    DCS50.1
  • Isotype

    IgG1
  • Research areas

    • Cell Biology
    • Cell Cycle
    • Cell Cycle Inhibitors
    • Ink4
    • Epigenetics and Nuclear Signaling
    • Cell cycle
    • Cell Cycle Inhibitors
    • Ink4
    • Cancer
    • Cell cycle
    • Cell cycle inhibitors
    • Ink4
    • Cancer
    • Oncoproteins/suppressors
    • Tumor suppressors
    • INK4a/Arf

Images

  • Western blot - Anti-CDKN2A/p16INK4a antibody [DCS50.1] (ab16123)
    Western blot - Anti-CDKN2A/p16INK4a antibody [DCS50.1] (ab16123)
    All lanes : Anti-CDKN2A/p16INK4a antibody [DCS50.1] (ab16123) at 1 µg/ml

    Lane 1 : HeLa (Human epithelial carcinoma cell line) Whole Cell Lysate
    Lane 2 : HEK293 (Human embryonic kidney cell line) Whole Cell Lysate

    Lysates/proteins at 10 µg per lane.

    Secondary
    All lanes : Goat Anti-Mouse IgG H&L (HRP) preadsorbed (ab97040) at 1/5000 dilution

    Developed using the ECL technique.

    Performed under reducing conditions.

    Predicted band size: 16 kDa
    Observed band size: 16 kDa
    Additional bands at: 37 kDa, 50 kDa. We are unsure as to the identity of these extra bands.


    Exposure time: 12 minutes
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CDKN2A/p16INK4a antibody [DCS50.1] (ab16123)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CDKN2A/p16INK4a antibody [DCS50.1] (ab16123)

    Immunohistochemical analysis of formalin-fixed, paraffin-embedded bladder tumor tissue labelling CDKN2A/p16INK4a with ab16123 at 10µg/ml.

  • Immunocytochemistry/ Immunofluorescence - Anti-CDKN2A/p16INK4a antibody [DCS50.1] (ab16123)
    Immunocytochemistry/ Immunofluorescence - Anti-CDKN2A/p16INK4a antibody [DCS50.1] (ab16123)

    ICC/IF image of ab16123 stained Hepp cells. The cells were 4% formaldehyde fixed (10 min) and then incubated in 1%BSA / 10% normal goat serum / 0.3M glycine in 0.1% PBS-Tween for 1h to permeabilise the cells and block non-specific protein-protein interactions. The cells were then incubated with the antibody (ab16123, 1µg/ml) overnight at +4°C. The secondary antibody (green) was Alexa Fluor® 488 goat anti-mouse IgG (H+L) ab150113) used at a 1/1000 dilution for 1h. Alexa Fluor® 594 WGA was used to label plasma membranes (red) at a 1/200 dilution for 1h. DAPI was used to stain the cell nuclei (blue) at a concentration of 1.43µM.

  • Flow Cytometry - Anti-CDKN2A/p16INK4a antibody [DCS50.1] (ab16123)
    Flow Cytometry - Anti-CDKN2A/p16INK4a antibody [DCS50.1] (ab16123)

    Overlay histogram showing HEK293 cells stained with ab16123 (red line). The cells were fixed with 4% paraformaldehyde (10 min) and incubated in 1x PBS / 10% normal goat serum / 0.3M glycine to block non-specific protein-protein interactions. The cells were then incubated with the antibody (ab16123, 1µg/1x106 cells ) for 30 min at 22ºC. The secondary antibody used was DyLight® 488 goat anti-mouse IgG (H+L) (ab96879) at 1/500 dilution for 30 min at 22ºC. Isotype control antibody (black line) was mouse IgG1 [ICIGG1] (ab91353, 2µg/1x106 cells) used under the same conditions. Acquisition of >5,000 events was performed. This antibody gave a positive signal in HEK293 cells fixed with 100% methanol used under the same conditions.

    Please note that Abcam do not have any data for use of this antibody on non-fixed cells. We welcome any customer feedback.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Alternative products to Anti-CDKN2A/p16INK4a antibody [DCS50.1] (ab16123)

  •  
  • Product image

    Alexa Fluor® 488 Anti-CDKN2A/p16INK4a antibody [EP435Y-129R] (ab199756)

    Applications: Flow Cyt, ICC/IF

  •  
  • Product image

    Anti-CDKN2A/p16INK4a antibody [EPR1473] - C-terminal (ab108349)

    Applications: Flow Cyt, ICC/IF, IHC-P, IP, WB

  •  
  • Product image

    Alexa Fluor® 647 Anti-CDKN2A/p16INK4a antibody [EPR1473] (ab192054)

    Applications: Flow Cyt, ICC/IF

  •  
  • Product image

    Anti-CDKN2A/p16INK4a antibody [EP435Y-129R] (ab81278)

    Applications: Flow Cyt, ICC/IF, WB

  •  
  • Product image

    Anti-CDKN2A/p16INK4a antibody [EPR20418] - BSA and Azide free (ab232402)

    Applications: Flow Cyt, ICC/IF, IP, WB

  •  
  • Product image

    Anti-CDKN2A/p16INK4a antibody [EPR1473] - BSA and Azide free (ab186932)

    Applications: Flow Cyt, ICC, IHC-P, IP, WB

  •  
  • Product image

    Anti-CDKN2A/p16INK4a antibody [EPR20418] (ab211542)

    Applications: Flow Cyt, ICC/IF, IP, WB

Clear all

Recently viewed products

  •  
  • Product image

    Anti-LINC00299 antibody (ab234653)

  •  
  • HC-030031, TRPA1 blocker (ab120554)

Get resources and offers direct to your inbox Sign up
© 2021 Astana Biomed Group LLP. All rights reserved.